prot_P-wetherbeei_contig1032.4.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Match: A0A2R5G436_9STRA (Uncharacterized protein n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5G436_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 5.700e-8 Identity = 25/34 (73.53%), Postives = 26/34 (76.47%), Query Frame = 0 Query: 3 TTAVAVGYSTGFLPLKIPLAPLLNVVFCWFPFFD 36 TT V STGFLPL IPLAPLLN+V CWFPF D Sbjct: 93 TTLKVVDGSTGFLPLTIPLAPLLNIVLCWFPFGD 126
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Match: D7FLG9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FLG9_ECTSI) HSP 1 Score: 46.6 bits (109), Expect = 6.830e-5 Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 9 GYSTGFLPLKIPLAPLLNVVFCWFPFFD 36 GYSTGFLPLKIPLA L+N+ C+ PF D Sbjct: 142 GYSTGFLPLKIPLACLINIPLCFIPFSD 169 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig1032.4.1 ID=prot_P-wetherbeei_contig1032.4.1|Name=mRNA_P-wetherbeei_contig1032.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=36bpback to top |