prot_P-wetherbeei_contig10295.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10295.1.1 vs. uniprot
Match: D7G0U5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0U5_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 6.400e-8 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 0 Query: 257 EEVCLPEDIYGSVRVSEFWQGLSEYSSLANTYVYDDIWASGG 298 E+V LP+DIYG+ RVSE+W G+ SSLA+TYVYDDIWA G Sbjct: 33 EQVSLPDDIYGAARVSEYWHGVPALSSLASTYVYDDIWAGDG 74
BLAST of mRNA_P-wetherbeei_contig10295.1.1 vs. uniprot
Match: A0A6H5JYD8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYD8_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 6.900e-8 Identity = 28/42 (66.67%), Postives = 34/42 (80.95%), Query Frame = 0 Query: 257 EEVCLPEDIYGSVRVSEFWQGLSEYSSLANTYVYDDIWASGG 298 E+V LP+DIYG+ RVSE+W G+ SSLA+TYVYDDIWA G Sbjct: 222 EQVSLPDDIYGAARVSEYWHGVPALSSLASTYVYDDIWAGDG 263 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10295.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10295.1.1 ID=prot_P-wetherbeei_contig10295.1.1|Name=mRNA_P-wetherbeei_contig10295.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=432bpback to top |