prot_P-wetherbeei_contig10228.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10228.2.1 vs. uniprot
Match: D8LC61_ECTSI (Putative copper transporter n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LC61_ECTSI) HSP 1 Score: 75.5 bits (184), Expect = 2.320e-13 Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 0 Query: 8 LVRCLDEIGFMSAFISSSTT-EMLGPGDDSSAVWAIAAALGLVDRGCAMAWGGECSCDPSNCRCVNCTIHVSEAASAVNEV 87 L LD IGF S+ ++++TT E D +AVWAIA ALGLVD GCAMAWG CSC +CRC+NC H+ + + AV+ V Sbjct: 733 LTSALDAIGFGSSCVATTTTQEPTLEQDGVNAVWAIANALGLVDPGCAMAWGRPCSCG-DDCRCINCPQHMKKVSHAVDLV 812 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10228.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10228.2.1 ID=prot_P-wetherbeei_contig10228.2.1|Name=mRNA_P-wetherbeei_contig10228.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=127bpback to top |