prot_P-wetherbeei_contig10083.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: A0A251SAT2_HELAN (Putative alpha/Beta hydrolase fold protein n=1 Tax=Helianthus annuus TaxID=4232 RepID=A0A251SAT2_HELAN) HSP 1 Score: 50.4 bits (119), Expect = 1.090e-5 Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGT--WQHGDLVVTTPWIRSEGADIVRHAIDNAL 52 E L L+ L WE+VD+ F GS H + V TPW+ S+GAD+++H +DN L Sbjct: 361 ETMLRGLSQLCWERVDVSFKGSKQRYLAHNTIQVNTPWMNSDGADVIQHMVDNFL 415
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: A0A251VH02_HELAN (Putative alpha/beta-Hydrolases superfamily protein n=1 Tax=Helianthus annuus TaxID=4232 RepID=A0A251VH02_HELAN) HSP 1 Score: 50.1 bits (118), Expect = 1.490e-5 Identity = 21/53 (39.62%), Postives = 34/53 (64.15%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGT--WQHGDLVVTTPWIRSEGADIVRHAIDN 50 EA + L + WE++D+ F GS + H + V +PWI S+GAD+++H +DN Sbjct: 348 EAMIRGLTKISWERIDVSFKGSKQRYFAHNTIQVNSPWINSDGADVIQHLVDN 400
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: UPI001CB9B8B3 (uncharacterized protein LOC122607624 n=1 Tax=Erigeron canadensis TaxID=72917 RepID=UPI001CB9B8B3) HSP 1 Score: 49.7 bits (117), Expect = 2.040e-5 Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGT--WQHGDLVVTTPWIRSEGADIVRHAIDN 50 E + L + WE+VD+ F GS + H + V TPW+ S+GADI++H +DN Sbjct: 349 EEMIRGLTKINWERVDVSFKGSKQRYFAHNTIQVNTPWLNSDGADIIQHIVDN 401
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: UPI001CB8EF56 (putative lipase C4A8.10 n=1 Tax=Erigeron canadensis TaxID=72917 RepID=UPI001CB8EF56) HSP 1 Score: 49.7 bits (117), Expect = 2.040e-5 Identity = 22/55 (40.00%), Postives = 35/55 (63.64%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGT--WQHGDLVVTTPWIRSEGADIVRHAIDNAL 52 E + L+ + WE+VD+ F GS + H + V TPW+ S+GAD+++H +DN L Sbjct: 351 ETMIKGLSKVKWERVDVSFKGSKQRYFAHNTIQVNTPWMNSDGADVIQHMVDNFL 405
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: A0A2U1MBE9_ARTAN (Alpha/beta-Hydrolases superfamily protein n=3 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1MBE9_ARTAN) HSP 1 Score: 49.7 bits (117), Expect = 2.040e-5 Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGT--WQHGDLVVTTPWIRSEGADIVRHAIDN 50 E + L + WE+VD+ F GS + H + V TPW+ S+GADI++H +DN Sbjct: 353 ETMIRGLTKISWERVDVSFKGSKQRYFAHNTIQVNTPWMNSDGADIIQHIVDN 405
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Match: A0A7N0VHC7_KALFE (DUF676 domain-containing protein n=1 Tax=Kalanchoe fedtschenkoi TaxID=63787 RepID=A0A7N0VHC7_KALFE) HSP 1 Score: 48.1 bits (113), Expect = 7.110e-5 Identity = 22/55 (40.00%), Postives = 33/55 (60.00%), Query Frame = 0 Query: 1 EASLTALADLGWEQVDI-FNGSGTWQ--HGDLVVTTPWIRSEGADIVRHAIDNAL 52 E + L + WE++D+ F+G W H + V TP+I SEGAD++ H +DN L Sbjct: 295 EEMIRGLTKVSWERIDVGFSGFKQWVLGHSTIQVKTPFIHSEGADVIAHMVDNFL 349 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10083.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10083.2.1 ID=prot_P-wetherbeei_contig10083.2.1|Name=mRNA_P-wetherbeei_contig10083.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=59bpback to top |