prot_P-wetherbeei_contig10.3.2 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10.3.2 vs. uniprot
Match: A0A7S2R4S1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2R4S1_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 5.650e-9 Identity = 37/65 (56.92%), Postives = 39/65 (60.00%), Query Frame = 0 Query: 832 VPLIVLPLRLPQPRHTTWVGMPSNHRADDDPVLRYVPYFGDNDHGALFPVVKMDGMDVSAYDMVP 896 VP LPL LP PR T W + N RADDDPVLRYVPYFGD D G+DVS YD VP Sbjct: 142 VPACRLPLVLPLPRSTVWTSIMLNWRADDDPVLRYVPYFGDEDQT---------GLDVSFYDSVP 197
BLAST of mRNA_P-wetherbeei_contig10.3.2 vs. uniprot
Match: A0A2D4C4C1_PYTIN (Polycomb-like protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4C4C1_PYTIN) HSP 1 Score: 59.3 bits (142), Expect = 3.530e-5 Identity = 29/55 (52.73%), Postives = 38/55 (69.09%), Query Frame = 0 Query: 833 PLIVLPLRLPQPRHTTWVGMPSNHRADDDPVLRYVPYFGDNDHGALFPVVKMDGM 887 PL + PLR P R TT+V P++ R DDDP+LRYVPYFGD+D G + + DG+ Sbjct: 3 PLALAPLR-PLSRLTTFVSAPTSVRVDDDPILRYVPYFGDDDRGDAIDLQRYDGV 56 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10.3.2 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig10.3.2 ID=prot_P-wetherbeei_contig10.3.2|Name=mRNA_P-wetherbeei_contig10.3.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=923bpback to top |