mRNA_P-wetherbeei_contig9959.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9959.1.1 vs. uniprot
Match: D7FL11_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FL11_ECTSI) HSP 1 Score: 52.8 bits (125), Expect = 1.260e-7 Identity = 21/42 (50.00%), Postives = 28/42 (66.67%), Query Frame = 1 Query: 16 RVWFPNMFMTLISALPTKRTPECRFRVPPRMTKWDIKEYLLK 141 R WFPNM M +IS R + F++ P+MTKW++KEYL K Sbjct: 4 RSWFPNMVMAMISGPSRSRPAQASFKIQPKMTKWEVKEYLTK 45
BLAST of mRNA_P-wetherbeei_contig9959.1.1 vs. uniprot
Match: A0A7S3HDG0_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HDG0_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 5.280e-6 Identity = 23/42 (54.76%), Postives = 28/42 (66.67%), Query Frame = 1 Query: 16 RVWFPNMFMTLISALPTKRTPECRFRVPPRMTKWDIKEYLLK 141 RV+FP+MFM LI+ P K P+ VPP MTK +I EYL K Sbjct: 8 RVFFPSMFMRLITWKPKKTPPQALLHVPPSMTKHEISEYLTK 49
BLAST of mRNA_P-wetherbeei_contig9959.1.1 vs. uniprot
Match: A0A835YVT8_9STRA (Ribosomal protein L23/L15e core domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YVT8_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 1.620e-5 Identity = 22/42 (52.38%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 22 WFPNMFMTLISALPTKRTPE-CRFRVPPRMTKWDIKEYLLKA 144 WFP+ FM L++ +PT+ P+ FRV P+MTK ++KEYLLK Sbjct: 6 WFPSFFMQLVT-MPTRGRPQQAAFRVSPKMTKLEVKEYLLKV 46
BLAST of mRNA_P-wetherbeei_contig9959.1.1 vs. uniprot
Match: A0A7S2W937_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W937_9STRA) HSP 1 Score: 46.2 bits (108), Expect = 6.940e-5 Identity = 25/43 (58.14%), Postives = 29/43 (67.44%), Query Frame = 1 Query: 22 WFPNMFMTLIS---ALPTKRTPECRFRVPPRMTKWDIKEYLLK 141 +FPNMFMTL+S A + P FRVPP MTK +IKEYL K Sbjct: 34 FFPNMFMTLLSVRNAGSKTKAPLAIFRVPPAMTKLEIKEYLTK 76 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9959.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9959.1.1 >prot_P-wetherbeei_contig9959.1.1 ID=prot_P-wetherbeei_contig9959.1.1|Name=mRNA_P-wetherbeei_contig9959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=48bp MPSSPRVWFPNMFMTLISALPTKRTPECRFRVPPRMTKWDIKEYLLKAback to top mRNA from alignment at P-wetherbeei_contig9959:369..512+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9959.1.1 ID=mRNA_P-wetherbeei_contig9959.1.1|Name=mRNA_P-wetherbeei_contig9959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig9959:369..512+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9959:369..512+ >mRNA_P-wetherbeei_contig9959.1.1 ID=mRNA_P-wetherbeei_contig9959.1.1|Name=mRNA_P-wetherbeei_contig9959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig9959:369..512+ (Phaeothamnion wetherbeei SAG_119_79)back to top |