mRNA_P-wetherbeei_contig992.6.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: D7FIH1_ECTSI (Eukaryotic translation initiation factor 4E like2 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIH1_ECTSI) HSP 1 Score: 76.6 bits (187), Expect = 7.390e-16 Identity = 34/48 (70.83%), Postives = 43/48 (89.58%), Query Frame = 1 Query: 1 QVRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 +VRF +GERLKQVLDLEPST++EYK H+++++DMSTFRNAK Y FA T Sbjct: 171 KVRFNIGERLKQVLDLEPSTLIEYKHHQTAMQDMSTFRNAKAYCFAVT 218
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: F0W9A8_9STRA (Eukaryotic initiation factor 4E putative n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0W9A8_9STRA) HSP 1 Score: 74.3 bits (181), Expect = 4.130e-15 Identity = 32/47 (68.09%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 4 VRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 VRF +GE+LK++L L+P+T++EYKFH +SI+DMSTFRNAK YVFA T Sbjct: 154 VRFSIGEKLKEILMLDPNTLIEYKFHANSIRDMSTFRNAKSYVFATT 200
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A2D4BW06_PYTIN (RNA helicase n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BW06_PYTIN) HSP 1 Score: 75.1 bits (183), Expect = 1.400e-14 Identity = 32/47 (68.09%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 QVRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAA 141 + RF++GE+LK++L L+P+T++EYKFH +SIKDMSTFRNAK YVFAA Sbjct: 839 ETRFKIGEKLKEILMLDPNTLIEYKFHANSIKDMSTFRNAKPYVFAA 885
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A8K1CP93_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CP93_PYTOL) HSP 1 Score: 72.0 bits (175), Expect = 3.300e-14 Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 1 QVRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAA 141 + RF++GE+LK++L L+ +T++EYKFH +SIKDMSTFRNAK YVFAA Sbjct: 159 ETRFKIGEKLKEILMLDANTLIEYKFHANSIKDMSTFRNAKPYVFAA 205
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: K3WZ97_GLOUD (Uncharacterized protein n=2 Tax=Pythiaceae TaxID=4782 RepID=K3WZ97_GLOUD) HSP 1 Score: 71.2 bits (173), Expect = 5.890e-14 Identity = 31/46 (67.39%), Postives = 41/46 (89.13%), Query Frame = 1 Query: 7 RFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 RF +GE+LK++L L+ +T++EYKFH +SI+DMSTFRNAK YVFAAT Sbjct: 158 RFEIGEKLKEILMLDSNTLIEYKFHANSIRDMSTFRNAKPYVFAAT 203
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: M4BUU5_HYAAE (Uncharacterized protein n=2 Tax=Peronosporaceae TaxID=4777 RepID=M4BUU5_HYAAE) HSP 1 Score: 68.9 bits (167), Expect = 8.500e-14 Identity = 30/45 (66.67%), Postives = 40/45 (88.89%), Query Frame = 1 Query: 7 RFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAA 141 RF +GE+LK++L L+ +T++EYKFH +SI+DMSTFRNAK YVFAA Sbjct: 70 RFAIGEKLKEILMLDSNTLIEYKFHANSIRDMSTFRNAKPYVFAA 114
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A024GBW3_9STRA (CBM20 domain-containing protein n=2 Tax=Albugo TaxID=65356 RepID=A0A024GBW3_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 9.080e-14 Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 4 VRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 VRF +GE+LK++L L+P+T++EYKFH +SI+DMSTFRNAK YVFA + Sbjct: 1348 VRFSIGEKLKEILMLDPNTLIEYKFHANSIRDMSTFRNAKSYVFATS 1394
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A024TXL0_9STRA (Uncharacterized protein n=3 Tax=Aphanomyces TaxID=100860 RepID=A0A024TXL0_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 1.130e-13 Identity = 30/47 (63.83%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 4 VRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 +RF +GE+LK++L L+ +T++EYKFH +SI+DMSTFRNAK YVFAA+ Sbjct: 153 IRFAIGEKLKEILMLDSNTLIEYKFHANSIRDMSTFRNAKPYVFAAS 199
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A485KQ57_9STRA (Aste57867_10365 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KQ57_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 1.470e-13 Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 4 VRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 VRF +GE+LK++L L+ +T++EYKFH +SI+DMSTFRNAK YVFAA+ Sbjct: 196 VRFAIGEKLKEILMLDSNTLIEYKFHANSIRDMSTFRNAKPYVFAAS 242
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Match: A0A418EM12_9STRA (Peptidase_M14 domain-containing protein n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A418EM12_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 3.160e-13 Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 4 VRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAAT 144 VRF +GE+LK++L L+ +T++EYKFH +SI+DMSTFRNAK YVFAA+ Sbjct: 1082 VRFAIGEKLKEILMLDSNTLIEYKFHSNSIRDMSTFRNAKPYVFAAS 1128 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig992.6.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig992.6.1 >prot_P-wetherbeei_contig992.6.1 ID=prot_P-wetherbeei_contig992.6.1|Name=mRNA_P-wetherbeei_contig992.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=48bp QVRFRVGERLKQVLDLEPSTMVEYKFHKSSIKDMSTFRNAKQYVFAATback to top mRNA from alignment at P-wetherbeei_contig992:7851..7994- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig992.6.1 ID=mRNA_P-wetherbeei_contig992.6.1|Name=mRNA_P-wetherbeei_contig992.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig992:7851..7994- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig992:7851..7994- >mRNA_P-wetherbeei_contig992.6.1 ID=mRNA_P-wetherbeei_contig992.6.1|Name=mRNA_P-wetherbeei_contig992.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig992:7851..7994- (Phaeothamnion wetherbeei SAG_119_79)back to top |