mRNA_P-wetherbeei_contig9743.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Match: A0A1W5CYZ0_9LECA (WSC domain-containing protein n=1 Tax=Lasallia pustulata TaxID=136370 RepID=A0A1W5CYZ0_9LECA) HSP 1 Score: 61.6 bits (148), Expect = 4.360e-8 Identity = 30/74 (40.54%), Postives = 39/74 (52.70%), Query Frame = 1 Query: 148 ATAKFRVTCETFASGAFMDPLEYPGKRSSHRHDIGGSLGFNANRVNAKAMQLNVSTCDILGDFSNYWAPTFYFH 369 A A +R+ C+T DP+ PGK S H H I G GF+ A S+C ++GD SNYW PT Y+H Sbjct: 21 AVAFWRLPCKTPIVVERADPVISPGKPSGHVHTIMGGNGFSFTMDYASTQSSTCSSCTVIGDKSNYWVPTLYYH 94
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Match: A0A5M8PEJ8_9LECA (Uncharacterized protein n=1 Tax=Lasallia pustulata TaxID=136370 RepID=A0A5M8PEJ8_9LECA) HSP 1 Score: 61.6 bits (148), Expect = 4.590e-8 Identity = 30/74 (40.54%), Postives = 39/74 (52.70%), Query Frame = 1 Query: 148 ATAKFRVTCETFASGAFMDPLEYPGKRSSHRHDIGGSLGFNANRVNAKAMQLNVSTCDILGDFSNYWAPTFYFH 369 A A +R+ C+T DP+ PGK S H H I G GF+ A S+C ++GD SNYW PT Y+H Sbjct: 21 AVAFWRLPCKTPIVVERADPVISPGKPSGHVHTIMGGNGFSFTMDYASTQSSTCSSCTVIGDKSNYWVPTLYYH 94 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9743.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9743.1.1 >prot_P-wetherbeei_contig9743.1.1 ID=prot_P-wetherbeei_contig9743.1.1|Name=mRNA_P-wetherbeei_contig9743.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=163bp TNSFDSIEKLLFEACSQRNPSNQVTSVARMSLLQIALQGTFLAVLGLQTAback to top mRNA from alignment at P-wetherbeei_contig9743:201..1730+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9743.1.1 ID=mRNA_P-wetherbeei_contig9743.1.1|Name=mRNA_P-wetherbeei_contig9743.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1530bp|location=Sequence derived from alignment at P-wetherbeei_contig9743:201..1730+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9743:201..1730+ >mRNA_P-wetherbeei_contig9743.1.1 ID=mRNA_P-wetherbeei_contig9743.1.1|Name=mRNA_P-wetherbeei_contig9743.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=489bp|location=Sequence derived from alignment at P-wetherbeei_contig9743:201..1730+ (Phaeothamnion wetherbeei SAG_119_79)back to top |