mRNA_P-wetherbeei_contig9738.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: B5Y4H3_PHATC (Predicted protein n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=B5Y4H3_PHATC) HSP 1 Score: 91.3 bits (225), Expect = 2.490e-15 Identity = 43/79 (54.43%), Postives = 51/79 (64.56%), Query Frame = 1 Query: 277 PMQPTLPWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFVPRAFPPSGTAAAAAE 513 P+ PWFY DPQ N+QGPF E+MRQW EAGYFK DLP+CQ GPF L LFP+ ++AF+ R P A AE Sbjct: 612 PVVADAPWFYSDPQRNIQGPFRGEEMRQWLEAGYFKGDLPICQQPTGPFHPLAALFPDLSKAFMARQGPNVEHEMAQAE 690
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: F0YBM2_AURAN (GYF domain-containing protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YBM2_AURAN) HSP 1 Score: 80.1 bits (196), Expect = 4.750e-15 Identity = 35/58 (60.34%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 295 PWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFV 468 PWFY+DPQ QGPF MRQWF AGYF +DLPL Q ++G FV L RLF + +AFV Sbjct: 4 PWFYKDPQGQHQGPFEAPQMRQWFNAGYFDDDLPLRQGESGDFVPLGRLFSSPQDAFV 61
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S3P8F0_9STRA (Hypothetical protein n=1 Tax=Amphora coffeiformis TaxID=265554 RepID=A0A7S3P8F0_9STRA) HSP 1 Score: 89.4 bits (220), Expect = 1.050e-14 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 1 Query: 283 QPTLPWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFV 468 +P PWFY DPQ N+QGPF +E+MRQW AGYFK DLP+CQ GPF+ L+ +FP+ AFV Sbjct: 641 RPDAPWFYSDPQGNIQGPFRSEEMRQWLMAGYFKGDLPVCQDPNGPFLALSSVFPDLNNAFV 702
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S3VDN2_9STRA (Hypothetical protein n=1 Tax=Chaetoceros debilis TaxID=122233 RepID=A0A7S3VDN2_9STRA) HSP 1 Score: 89.4 bits (220), Expect = 1.070e-14 Identity = 38/59 (64.41%), Postives = 46/59 (77.97%), Query Frame = 1 Query: 295 PWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFVP 471 PW+Y DPQ N+QGPF ++MRQW EAGYFK DLP+ QSQ+GPF ELNR F + + AF P Sbjct: 755 PWYYADPQGNIQGPFGGDEMRQWLEAGYFKGDLPISQSQSGPFRELNRCFLDSSVAFKP 813
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A1Z5JGA9_FISSO (GYF domain-containing protein n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JGA9_FISSO) HSP 1 Score: 87.8 bits (216), Expect = 3.020e-14 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 274 PPMQPTLPWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFV 468 P + P PW+Y DPQ+N+QGPF E+MRQW EAGYFK+DLP+ Q+Q GPF L+ FP+ + AFV Sbjct: 598 PAIIPGAPWYYSDPQNNIQGPFRGEEMRQWLEAGYFKSDLPISQNQTGPFKALSIWFPDISVAFV 662
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S4AH17_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia australis TaxID=44445 RepID=A0A7S4AH17_9STRA) HSP 1 Score: 86.7 bits (213), Expect = 6.200e-14 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 1 Query: 295 PWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFVPRAF 480 PWFY DPQ+N+QGPF E+MRQW EAGYFK DLP+ Q +GPF +L+ FP AF +AF Sbjct: 402 PWFYSDPQNNIQGPFRGEEMRQWLEAGYFKGDLPISQVPSGPFHQLSNWFPELDTAFTAKAF 463
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S1VEN3_9STRA (Hypothetical protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1VEN3_9STRA) HSP 1 Score: 86.7 bits (213), Expect = 7.720e-14 Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = 1 Query: 277 PMQPTLPWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAF 465 P+ P PWFY DPQ NVQGPF E+MRQW EAGYFK DLP+ Q +GPF L +F + + AF Sbjct: 823 PIDPAAPWFYSDPQGNVQGPFRGEEMRQWLEAGYFKGDLPISQDMSGPFRPLAAIFQDMSNAF 885
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S0YCF0_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia delicatissima TaxID=44447 RepID=A0A7S0YCF0_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 2.100e-13 Identity = 35/57 (61.40%), Postives = 44/57 (77.19%), Query Frame = 1 Query: 295 PWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAF 465 PWFY DPQ+N+QGPF E+MRQW EAGYFK DLP+ Q +GPF +L+ FP+ + AF Sbjct: 579 PWFYSDPQNNIQGPFRGEEMRQWLEAGYFKGDLPISQMHSGPFHQLSNWFPDLSTAF 635
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A7S1ZQA4_TRICV (Hypothetical protein (Fragment) n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1ZQA4_TRICV) HSP 1 Score: 80.1 bits (196), Expect = 2.760e-13 Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 1 Query: 295 PWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAFVP 471 PWFY DPQ N+QGPF +MRQW EAGYFK DLP+ Q++ G F L+ +FPN AF P Sbjct: 77 PWFYADPQGNIQGPFGGLEMRQWLEAGYFKGDLPISQNRNGQFRALSAIFPNLELAFQP 135
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Match: A0A448ZNU8_9STRA (GYF domain-containing protein n=1 Tax=Pseudo-nitzschia multistriata TaxID=183589 RepID=A0A448ZNU8_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 2.920e-13 Identity = 35/58 (60.34%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 292 LPWFYRDPQSNVQGPFTTEDMRQWFEAGYFKNDLPLCQSQAGPFVELNRLFPNHAEAF 465 +PW+Y DPQ+N+QGPF E+MRQW EAGYFK DLP+ Q GPF +L+ FPN + AF Sbjct: 697 VPWYYSDPQNNIQGPFRGEEMRQWLEAGYFKGDLPISQLPNGPFHQLSNWFPNLSTAF 754 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9738.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9738.1.1 >prot_P-wetherbeei_contig9738.1.1 ID=prot_P-wetherbeei_contig9738.1.1|Name=mRNA_P-wetherbeei_contig9738.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=630bp EQQQQRAAHQGGQPPLSYDEEQRRLAYQQQQQQQARQREQQQQHLNEERNback to top mRNA from alignment at P-wetherbeei_contig9738:22..2275+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9738.1.1 ID=mRNA_P-wetherbeei_contig9738.1.1|Name=mRNA_P-wetherbeei_contig9738.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=2254bp|location=Sequence derived from alignment at P-wetherbeei_contig9738:22..2275+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9738:22..2275+ >mRNA_P-wetherbeei_contig9738.1.1 ID=mRNA_P-wetherbeei_contig9738.1.1|Name=mRNA_P-wetherbeei_contig9738.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=1890bp|location=Sequence derived from alignment at P-wetherbeei_contig9738:22..2275+ (Phaeothamnion wetherbeei SAG_119_79)back to top |