mRNA_P-wetherbeei_contig9676.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9676.4.1 vs. uniprot
Match: UPI0018850E80 (leucine-rich repeat neuronal protein 2-like isoform X1 n=4 Tax=Pollicipes pollicipes TaxID=41117 RepID=UPI0018850E80) HSP 1 Score: 66.6 bits (161), Expect = 4.610e-10 Identity = 43/89 (48.31%), Postives = 57/89 (64.04%), Query Frame = 1 Query: 154 LSKLQHLDLSDNPGIGVLSGALPDGIGALFKLRILRLRGGHLPGLGKG-LGSLLSLTELDAGNNELAEVPPELFRLAELTVLRLDGNHI 417 LSKL+ LDLS NP + VL + L +LR+LRL G L L G L +L++L ELD G+N+LA VPP+L+ +T LRL+GN I Sbjct: 166 LSKLRELDLSYNP-LSVLDHHTVLAVTELARLRVLRLAGTGLRQLPTGFLHALITLRELDLGDNQLAVVPPDLYNSHAITSLRLNGNPI 253 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9676.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9676.4.1 >prot_P-wetherbeei_contig9676.4.1 ID=prot_P-wetherbeei_contig9676.4.1|Name=mRNA_P-wetherbeei_contig9676.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=143bp AAAAAAAAAAAAAAGPTAALQVDLLPLRQLQRLQLDGLRLSAVPPAVASGback to top mRNA from alignment at P-wetherbeei_contig9676:1931..2359+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9676.4.1 ID=mRNA_P-wetherbeei_contig9676.4.1|Name=mRNA_P-wetherbeei_contig9676.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=429bp|location=Sequence derived from alignment at P-wetherbeei_contig9676:1931..2359+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9676:1931..2359+ >mRNA_P-wetherbeei_contig9676.4.1 ID=mRNA_P-wetherbeei_contig9676.4.1|Name=mRNA_P-wetherbeei_contig9676.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=429bp|location=Sequence derived from alignment at P-wetherbeei_contig9676:1931..2359+ (Phaeothamnion wetherbeei SAG_119_79)back to top |