mRNA_P-wetherbeei_contig9523.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A6H5JJZ9_9PHAE (AAA domain-containing protein n=2 Tax=Ochrophyta TaxID=2696291 RepID=A0A6H5JJZ9_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 5.760e-13 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD ED ALDEGDIALLKTYGLGPY+T+IKDIEKEI AK++V Sbjct: 14 DYDGEDDDAPPAALDEGDIALLKTYGLGPYTTSIKDIEKEINEAKEQV 61
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A6V1T8U9_HETAK (Hypothetical protein n=2 Tax=Chattonellaceae TaxID=658124 RepID=A0A6V1T8U9_HETAK) HSP 1 Score: 65.5 bits (158), Expect = 3.390e-11 Identity = 33/48 (68.75%), Postives = 36/48 (75.00%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD+E ALDEGDIALLKTYGLGPY+ AIK IE EI +KDKV Sbjct: 14 DYDEEQDEKPTKALDEGDIALLKTYGLGPYTNAIKKIEDEINKSKDKV 61
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7S3Y2G3_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y2G3_HETAK) HSP 1 Score: 61.6 bits (148), Expect = 7.800e-10 Identity = 30/48 (62.50%), Postives = 36/48 (75.00%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD+E+ ALDEGDIALLKTYG+GPY+ AIK E+EI + DKV Sbjct: 107 DYDEEEGDKPTKALDEGDIALLKTYGVGPYTNAIKKAEEEISKSMDKV 154
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: B5Y3S3_PHATC (Predicted protein n=5 Tax=Bacillariophycidae TaxID=33850 RepID=B5Y3S3_PHATC) HSP 1 Score: 60.1 bits (144), Expect = 2.720e-9 Identity = 29/48 (60.42%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD+E+ LDEGDI LLK+YGLGPYST IKD+EKEI+ + V Sbjct: 13 DYDEEEKEDAPPPLDEGDIVLLKSYGLGPYSTKIKDVEKEIKKHQQTV 60
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7R9UDY0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9UDY0_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 7.610e-9 Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 DYDDEDXXXXXX-ALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYDD+D +LD GDIALLKTYGLGPY+ AIK +E EI++ +D+V Sbjct: 15 DYDDDDNNAAVGPSLDAGDIALLKTYGLGPYTEAIKKVEAEIKTHQDRV 63
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7S2I8S1_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2I8S1_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 1.550e-8 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIE 126 DYDDE+ LDE DIALLK+YGLGPY+T+IK+ E+EI+ Sbjct: 12 DYDDEEKEDTAPPLDEADIALLKSYGLGPYATSIKEAEEEIK 53
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7S2CGH0_9STRA (Hypothetical protein n=3 Tax=Dictyochophyceae TaxID=39119 RepID=A0A7S2CGH0_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 2.430e-8 Identity = 27/48 (56.25%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD+E+ LDEGDIALLKTYG+GPY+ IK EKEI+ ++K+ Sbjct: 13 DYDEEEDEAPVPVLDEGDIALLKTYGVGPYTNKIKSTEKEIKEHQEKL 60
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A392M6Q6_9FABA (26S protease regulatory subunit 7-like (Fragment) n=1 Tax=Trifolium medium TaxID=97028 RepID=A0A392M6Q6_9FABA) HSP 1 Score: 53.1 bits (126), Expect = 2.950e-8 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 1 Query: 40 LDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 LDE DIALLKTYGLGPYST IK +EKEI+ KV Sbjct: 17 LDEDDIALLKTYGLGPYSTGIKKVEKEIKDMAKKV 51
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7S3HF68_9STRA (Hypothetical protein (Fragment) n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HF68_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 4.670e-8 Identity = 28/48 (58.33%), Postives = 34/48 (70.83%), Query Frame = 1 Query: 1 DYDDEDXXXXXXALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYD ED ALDEGDIALLKTYG+GPY+ AIK E +I+ ++ V Sbjct: 13 DYDKEDDDKPIIALDEGDIALLKTYGIGPYTNAIKAAEDDIKKHQETV 60
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Match: A0A7R9UG07_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9UG07_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 5.600e-8 Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 DYDDEDXXXXXX-ALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKV 144 DYDD+D +LD GDIALLKTYGLGPY+ AIK +E EI++ +D+V Sbjct: 15 DYDDDDNNAAVGPSLDAGDIALLKTYGLGPYTEAIKKVEAEIKTHQDRV 63 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9523.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9523.1.1 >prot_P-wetherbeei_contig9523.1.1 ID=prot_P-wetherbeei_contig9523.1.1|Name=mRNA_P-wetherbeei_contig9523.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=48bp DYDDEDEEPPPPALDEGDIALLKTYGLGPYSTAIKDIEKEIESAKDKVback to top mRNA from alignment at P-wetherbeei_contig9523:675..818- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9523.1.1 ID=mRNA_P-wetherbeei_contig9523.1.1|Name=mRNA_P-wetherbeei_contig9523.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig9523:675..818- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9523:675..818- >mRNA_P-wetherbeei_contig9523.1.1 ID=mRNA_P-wetherbeei_contig9523.1.1|Name=mRNA_P-wetherbeei_contig9523.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig9523:675..818- (Phaeothamnion wetherbeei SAG_119_79)back to top |