mRNA_P-wetherbeei_contig12976.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12976.1.1 vs. uniprot
Match: A0A2D4CHK2_PYTIN (Tubulin-tyrosine ligase family (Fragment) n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CHK2_PYTIN) HSP 1 Score: 58.9 bits (141), Expect = 1.680e-9 Identity = 31/83 (37.35%), Postives = 43/83 (51.81%), Query Frame = 1 Query: 25 LVNVLSRRLDRVSDGQP-----NASLRHHRHASRAGKSALDVDLDSILLGAVPRRYGEMPCDPGGYLRLSPGTALYRRALRFR 258 L +VL RR + N + RH R A ++ DL +ILLG VPR+YGE+P G Y RL P T LY + ++ + Sbjct: 1 LADVLRRRFHEAESERRRVHSVNHNARHPREAEELAAKQMNEDLAAILLGQVPRQYGELPAHLGSYSRLCPHTTLYNQLVKLK 83 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12976.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12976.1.1 >prot_P-wetherbeei_contig12976.1.1 ID=prot_P-wetherbeei_contig12976.1.1|Name=mRNA_P-wetherbeei_contig12976.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=86bp PERFCRDKLVNVLSRRLDRVSDGQPNASLRHHRHASRAGKSALDVDLDSIback to top mRNA from alignment at P-wetherbeei_contig12976:244..684+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12976.1.1 ID=mRNA_P-wetherbeei_contig12976.1.1|Name=mRNA_P-wetherbeei_contig12976.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=441bp|location=Sequence derived from alignment at P-wetherbeei_contig12976:244..684+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12976:244..684+ >mRNA_P-wetherbeei_contig12976.1.1 ID=mRNA_P-wetherbeei_contig12976.1.1|Name=mRNA_P-wetherbeei_contig12976.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=258bp|location=Sequence derived from alignment at P-wetherbeei_contig12976:244..684+ (Phaeothamnion wetherbeei SAG_119_79)back to top |