mRNA_P-wetherbeei_contig1288.2.3 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A835YZF9_9STRA (RmlC-like cupin domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YZF9_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 1.460e-16 Identity = 40/67 (59.70%), Postives = 50/67 (74.63%), Query Frame = 1 Query: 646 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 846 GVLT F+EENGG I +TV AG+ +F PQGLTH ++ +GCTPA +I+A DDF VQ +TTAL GL Sbjct: 78 GVLTAFVEENGGRTIENTVVAGEAAFFPQGLTHMQVNMGCTPATMIAALGSDDFGVQTITTTALEGL 144
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A836CNU2_9STRA (RmlC-like cupin domain-containing protein n=7 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNU2_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 2.790e-15 Identity = 38/67 (56.72%), Postives = 49/67 (73.13%), Query Frame = 1 Query: 646 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 846 GVLT F+EENGG I +T+ G+ +F PQGLTH ++ +GCTPA +I+A DDF VQ +TTAL GL Sbjct: 129 GVLTAFVEENGGRTIENTIVTGEAAFFPQGLTHVQVNMGCTPATMIAALGSDDFGVQTITTTALKGL 195
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Match: A0A835Z488_9STRA (RmlC-like cupin domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z488_9STRA) HSP 1 Score: 79.7 bits (195), Expect = 2.170e-13 Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 1 Query: 646 GVLTTFIEENGGGNITDTVYAGKISFSPQGLTHFELKIGCTPALLISAFRDDDFSVQQTSTTALAGL 846 GVLT F+EENGG I +T+ G+ +F PQGLTH ++ +GC PA +I+A DDF VQ ++ AL GL Sbjct: 130 GVLTAFVEENGGRTIENTIVTGEAAFFPQGLTHVQVNMGCAPATMIAALGSDDFGVQTITSAALKGL 196 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1288.2.3 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1288.2.3 >prot_P-wetherbeei_contig1288.2.3 ID=prot_P-wetherbeei_contig1288.2.3|Name=mRNA_P-wetherbeei_contig1288.2.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=185bp MLSFHFFDPNRPVSPTATSLAAVRHQYPPRAPTSNGAPDCDQRGPGGVLTback to top mRNA from alignment at P-wetherbeei_contig1288:4615..5979+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1288.2.3 ID=mRNA_P-wetherbeei_contig1288.2.3|Name=mRNA_P-wetherbeei_contig1288.2.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1365bp|location=Sequence derived from alignment at P-wetherbeei_contig1288:4615..5979+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1288:4615..5979+ >mRNA_P-wetherbeei_contig1288.2.3 ID=mRNA_P-wetherbeei_contig1288.2.3|Name=mRNA_P-wetherbeei_contig1288.2.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=555bp|location=Sequence derived from alignment at P-wetherbeei_contig1288:4615..5979+ (Phaeothamnion wetherbeei SAG_119_79)back to top |