mRNA_P-wetherbeei_contig1285.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1285.1.1 vs. uniprot
Match: A0A835Z0K6_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z0K6_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 2.750e-7 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 SLPRVLGKADDLAYEVEQEIRYEEPGRRTNRVLKPLGLALPGTAPAGDGSG 153 +LP +G ADDLAY VEQE+RYE+PGRRT +VL+ +G+ L G A + G G Sbjct: 445 ALPAAVGAADDLAYAVEQEVRYEKPGRRTTQVLRRVGIPLSGAAQSALGGG 495 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1285.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1285.1.1 >prot_P-wetherbeei_contig1285.1.1 ID=prot_P-wetherbeei_contig1285.1.1|Name=mRNA_P-wetherbeei_contig1285.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=208bp SLPRVLGKADDLAYEVEQEIRYEEPGRRTNRVLKPLGLALPGTAPAGDGSback to top mRNA from alignment at P-wetherbeei_contig1285:353..1229- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1285.1.1 ID=mRNA_P-wetherbeei_contig1285.1.1|Name=mRNA_P-wetherbeei_contig1285.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=877bp|location=Sequence derived from alignment at P-wetherbeei_contig1285:353..1229- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1285:353..1229- >mRNA_P-wetherbeei_contig1285.1.1 ID=mRNA_P-wetherbeei_contig1285.1.1|Name=mRNA_P-wetherbeei_contig1285.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=624bp|location=Sequence derived from alignment at P-wetherbeei_contig1285:353..1229- (Phaeothamnion wetherbeei SAG_119_79)back to top |