mRNA_P-wetherbeei_contig12680.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12680.2.1 vs. uniprot
Match: A0A7W0GI36_9ACTN (Gamma-glutamylcyclotransferase n=2 Tax=Geodermatophilaceae bacterium TaxID=1882271 RepID=A0A7W0GI36_9ACTN) HSP 1 Score: 51.2 bits (121), Expect = 5.920e-6 Identity = 36/88 (40.91%), Postives = 45/88 (51.14%), Query Frame = 1 Query: 7 YGSN-NVEQMRARC-ESPMLWSRPAVLRGWTRVFAARVAAWGGGSVANVAPMDGGEVFGALYMLTPQELHRLDMFEGVAQGHYAKTPV 264 YGSN + QMR RC SP + +RGW F W G ++A + P GEVF ALY +TP + LD +EG G Y K V Sbjct: 7 YGSNMDPAQMRQRCPHSPSAGA--GWVRGWRLTFGGEQLGWEG-ALATIVPDPSGEVFVALYDVTPYDEGILDAWEGADHGLYRKLRV 91
BLAST of mRNA_P-wetherbeei_contig12680.2.1 vs. uniprot
Match: A0A662JKK6_9CREN (Uncharacterized protein n=1 Tax=Thermoprotei archaeon TaxID=2250277 RepID=A0A662JKK6_9CREN) HSP 1 Score: 48.1 bits (113), Expect = 9.570e-5 Identity = 33/91 (36.26%), Postives = 44/91 (48.35%), Query Frame = 1 Query: 1 FCYGSN-NVEQMRARCESPMLWSRPAVLRGWTRVFAARVAAWGGGSVANVAPMDGGEVFGALYMLTPQELHRLDMFEGVAQGHYAKTPVAV 270 F YG N NV + R P+ R +L G+ F+ G A V P V GALY++T ++L +LD FEGV GHY V + Sbjct: 9 FAYGRNVNVNFLVGRAGKPIAMFR-GILPGYKLEFSKVPGPRSGVGYATVVPAAREWVEGALYLMTEEQLAKLDEFEGVPTGHYRHEDVKI 98 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12680.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12680.2.1 >prot_P-wetherbeei_contig12680.2.1 ID=prot_P-wetherbeei_contig12680.2.1|Name=mRNA_P-wetherbeei_contig12680.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=80bp MRARCESPMLWSRPAVLRGWTRVFAARVAAWGGGSVANVAPMDGGEVFGAback to top mRNA from alignment at P-wetherbeei_contig12680:619..888- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12680.2.1 ID=mRNA_P-wetherbeei_contig12680.2.1|Name=mRNA_P-wetherbeei_contig12680.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=270bp|location=Sequence derived from alignment at P-wetherbeei_contig12680:619..888- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12680:619..888- >mRNA_P-wetherbeei_contig12680.2.1 ID=mRNA_P-wetherbeei_contig12680.2.1|Name=mRNA_P-wetherbeei_contig12680.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=240bp|location=Sequence derived from alignment at P-wetherbeei_contig12680:619..888- (Phaeothamnion wetherbeei SAG_119_79)back to top |