mRNA_P-wetherbeei_contig12651.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A835ZBS8_9STRA (Chloroplast 30S ribosomal protein 21 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBS8_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 9.490e-9 Identity = 27/37 (72.97%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRK 111 VESA+TRF+RAV R+GH+ ELK+RR+FETTQ R+KRK Sbjct: 54 VESALTRFKRAVGRSGHMQELKYRRYFETTQERKKRK 90
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7R9W5B5_9STRA (Hypothetical protein n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9W5B5_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 1.980e-7 Identity = 24/40 (60.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL EL+HRRFFE +Q ++KRK+ Q Sbjct: 50 IESALRRFKREVNKSGHLMELRHRRFFENSQEKKKRKIVQ 89
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S2UNK4_9STRA (Hypothetical protein n=1 Tax=Attheya septentrionalis TaxID=420275 RepID=A0A7S2UNK4_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 5.440e-7 Identity = 23/40 (57.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL EL+H+R+FE TQ ++KRK+ Q Sbjct: 66 IESALRRFKREVNKSGHLMELRHKRYFENTQEKKKRKIVQ 105
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S2RCI3_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2RCI3_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 8.450e-7 Identity = 24/40 (60.00%), Postives = 33/40 (82.50%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL EL+HRR FE +Q R+KRK+ Q Sbjct: 53 IESALRRFKREVNKSGHLMELRHRRHFENSQERKKRKIVQ 92
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: B8BSD7_THAPS (Uncharacterized protein (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8BSD7_THAPS) HSP 1 Score: 49.3 bits (116), Expect = 9.620e-7 Identity = 22/40 (55.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL +L+H+R+FE +Q R+KRK+ Q Sbjct: 10 IESALRRFKREVNKSGHLMDLRHKRYFENSQDRKKRKIVQ 49
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S1Z7E6_TRICV (Hypothetical protein n=1 Tax=Trieres chinensis TaxID=1514140 RepID=A0A7S1Z7E6_TRICV) HSP 1 Score: 50.1 bits (118), Expect = 1.190e-6 Identity = 22/40 (55.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL EL+H+R+FE +Q ++KRK+ Q Sbjct: 53 IESALRRFKREVNKSGHLMELRHKRYFENSQEKKKRKLTQ 92
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S2Q4E9_9STRA (Hypothetical protein n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A7S2Q4E9_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 2.250e-6 Identity = 22/40 (55.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL +L+H+R+FE +Q R+KRK+ Q Sbjct: 49 IESALRRFKREVNKSGHLMDLRHKRYFENSQDRKKRKIVQ 88
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S2REA8_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2REA8_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 2.890e-6 Identity = 22/40 (55.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 +ESA+ RF+R VN++GHL +L+H+R+FE +Q R+KRK+ Q Sbjct: 62 IESALRRFKREVNKSGHLMDLRHKRYFENSQDRKKRKIVQ 101
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A8J9S2B3_PHATR (Hypothetical protein (Fragment) n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=A0A8J9S2B3_PHATR) HSP 1 Score: 47.8 bits (112), Expect = 3.190e-6 Identity = 22/38 (57.89%), Postives = 32/38 (84.21%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKM 114 +ESA+ RF+R VN++GHL EL+H+R+FE +Q R KRK+ Sbjct: 21 IESALRRFKREVNKSGHLMELRHKRYFENSQERIKRKV 58
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Match: A0A7S0GHG0_9STRA (Hypothetical protein n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0GHG0_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 1.610e-5 Identity = 23/40 (57.50%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 1 VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQ 120 VES I RF+R VN++GHL +L+H+R FE +Q R+KRK+ Q Sbjct: 64 VESIIRRFKREVNKSGHLMDLRHKRHFENSQQRKKRKIVQ 103 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12651.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12651.1.1 >prot_P-wetherbeei_contig12651.1.1 ID=prot_P-wetherbeei_contig12651.1.1|Name=mRNA_P-wetherbeei_contig12651.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=40bp VESAITRFRRAVNRAGHLGELKHRRFFETTQAREKRKMAQback to top mRNA from alignment at P-wetherbeei_contig12651:18..137- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12651.1.1 ID=mRNA_P-wetherbeei_contig12651.1.1|Name=mRNA_P-wetherbeei_contig12651.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=120bp|location=Sequence derived from alignment at P-wetherbeei_contig12651:18..137- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12651:18..137- >mRNA_P-wetherbeei_contig12651.1.1 ID=mRNA_P-wetherbeei_contig12651.1.1|Name=mRNA_P-wetherbeei_contig12651.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=120bp|location=Sequence derived from alignment at P-wetherbeei_contig12651:18..137- (Phaeothamnion wetherbeei SAG_119_79)back to top |