mRNA_P-wetherbeei_contig12539.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: D8LI84_ECTSI (WW domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LI84_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 4.140e-11 Identity = 29/40 (72.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 82 RRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEAV 201 RRNSTST+Y+ HDT+SDPD DATIRCVCAV RAH+ A+ Sbjct: 290 RRNSTSTIYLAAHDTLSDPDLDATIRCVCAVLRAHMIAAL 329
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S2SV86_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SV86_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 6.810e-10 Identity = 31/42 (73.81%), Postives = 35/42 (83.33%), Query Frame = 1 Query: 76 MSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEAV 201 M+RRNSTSTLYVG TMS PD+DATI+CVC V RAH+ EAV Sbjct: 187 MNRRNSTSTLYVG--STMSRPDKDATIKCVCTVIRAHMLEAV 226
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S0AG02_9STRA (Hypothetical protein (Fragment) n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A7S0AG02_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 9.880e-8 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 82 RRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEA 198 +RN+ TL+V TMSDPD+DATI+C+C +YRAHI +A Sbjct: 15 QRNTCGTLHVS--STMSDPDKDATIKCICGIYRAHIVQA 51
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: B7G6C6_PHATC (Predicted protein n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=B7G6C6_PHATC) HSP 1 Score: 56.2 bits (134), Expect = 1.420e-7 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 1 Query: 73 VMSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEA 198 + SRRN+ TLYVG TMSDPD+DA+I+CVC V RAHI ++ Sbjct: 650 IGSRRNTCGTLYVG--STMSDPDKDASIKCVCGVLRAHILQS 689
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S2EB28_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S2EB28_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 3.610e-7 Identity = 23/42 (54.76%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 76 MSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEAV 201 +++RN+ T+Y+G TMS PD+DATI+CVC VYRAH+ ++V Sbjct: 385 LTKRNTCGTIYIG--STMSAPDKDATIKCVCGVYRAHMLQSV 424
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S2I4W4_9STRA (Hypothetical protein n=1 Tax=Helicotheca tamesis TaxID=374047 RepID=A0A7S2I4W4_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 3.200e-6 Identity = 21/42 (50.00%), Postives = 34/42 (80.95%), Query Frame = 1 Query: 76 MSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEAV 201 +++RN+ T+Y+G TMS PD+DA+I+CVC V+RAH+ ++V Sbjct: 217 LAKRNTCGTIYIG--STMSAPDKDASIKCVCGVFRAHLLQSV 256
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S1BXU3_9STRA (Hypothetical protein n=1 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1BXU3_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 4.410e-6 Identity = 26/39 (66.67%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 82 RRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEA 198 RRNS TLYVG TMS PD DATI+CVCAV R HI ++ Sbjct: 320 RRNSGGTLYVG--STMSVPDIDATIKCVCAVIRTHIVQS 356
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7S2VYN1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2VYN1_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 5.630e-6 Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 76 MSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHI 189 +++RN+ T+YVG TMS PD DATI+C+C +YRAH+ Sbjct: 83 LAKRNTCGTMYVG--STMSAPDIDATIKCICGLYRAHL 118
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A1Z5JPI1_FISSO (WW domain-containing protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JPI1_FISSO) HSP 1 Score: 51.6 bits (122), Expect = 6.030e-6 Identity = 23/36 (63.89%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 82 RRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHI 189 RRN+ LYVG TMS PD DAT++C+C VYRAHI Sbjct: 408 RRNTCGNLYVG--STMSTPDSDATLKCICGVYRAHI 441
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Match: A0A7R9VHP5_9STRA (Hypothetical protein (Fragment) n=2 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9VHP5_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 6.090e-6 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 76 MSRRNSTSTLYVGPHDTMSDPDRDATIRCVCAVYRAHITEA 198 ++ RN+ T+YV TMS PD+DATI+CVC VYRAH+ +A Sbjct: 772 LAARNTCGTIYVS--STMSAPDKDATIKCVCGVYRAHMLQA 810 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12539.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 15
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12539.2.1 >prot_P-wetherbeei_contig12539.2.1 ID=prot_P-wetherbeei_contig12539.2.1|Name=mRNA_P-wetherbeei_contig12539.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=67bp GATGAAGAGGGGGPGSRRGSAASSVMSRRNSTSTLYVGPHDTMSDPDRDAback to top mRNA from alignment at P-wetherbeei_contig12539:1458..1940- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12539.2.1 ID=mRNA_P-wetherbeei_contig12539.2.1|Name=mRNA_P-wetherbeei_contig12539.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=483bp|location=Sequence derived from alignment at P-wetherbeei_contig12539:1458..1940- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12539:1458..1940- >mRNA_P-wetherbeei_contig12539.2.1 ID=mRNA_P-wetherbeei_contig12539.2.1|Name=mRNA_P-wetherbeei_contig12539.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=201bp|location=Sequence derived from alignment at P-wetherbeei_contig12539:1458..1940- (Phaeothamnion wetherbeei SAG_119_79)back to top |