mRNA_P-wetherbeei_contig12303.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: E8Z6K5_PFIPI (Glutathione S-transferase (Fragment) n=1 Tax=Pfiesteria piscicida TaxID=71001 RepID=E8Z6K5_PFIPI) HSP 1 Score: 58.2 bits (139), Expect = 6.050e-9 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 4 YPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHS 111 Y +RAW D+I ARPAV++GL+INSSS+ GI EYHS Sbjct: 211 YKNVRAWFDKISARPAVEKGLRINSSSDNGIREYHS 246
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: A0A0G4GYH4_9ALVE (Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4GYH4_9ALVE) HSP 1 Score: 51.2 bits (121), Expect = 1.520e-7 Identity = 21/37 (56.76%), Postives = 27/37 (72.97%), Query Frame = 1 Query: 1 TYPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHS 111 +Y L W+DR+ +RPAV+RGL +NS S GGI E HS Sbjct: 20 SYKNLNGWMDRVGSRPAVKRGLLVNSGSPGGIKERHS 56
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Match: A0A7S3PBB9_9STRA (Hypothetical protein n=2 Tax=Sar TaxID=2698737 RepID=A0A7S3PBB9_9STRA) HSP 1 Score: 47.0 bits (110), Expect = 7.580e-5 Identity = 19/37 (51.35%), Postives = 25/37 (67.57%), Query Frame = 1 Query: 4 YPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHSK 114 Y + W++ IE RPAV+RGLK+N E +PE HSK Sbjct: 258 YENVIRWIENIEERPAVKRGLKVNGWGENDLPERHSK 294 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12303.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12303.1.1 >prot_P-wetherbeei_contig12303.1.1 ID=prot_P-wetherbeei_contig12303.1.1|Name=mRNA_P-wetherbeei_contig12303.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=39bp TYPALRAWLDRIEARPAVQRGLKINSSSEGGIPEYHSK*back to top mRNA from alignment at P-wetherbeei_contig12303:751..867+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12303.1.1 ID=mRNA_P-wetherbeei_contig12303.1.1|Name=mRNA_P-wetherbeei_contig12303.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=117bp|location=Sequence derived from alignment at P-wetherbeei_contig12303:751..867+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12303:751..867+ >mRNA_P-wetherbeei_contig12303.1.1 ID=mRNA_P-wetherbeei_contig12303.1.1|Name=mRNA_P-wetherbeei_contig12303.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=117bp|location=Sequence derived from alignment at P-wetherbeei_contig12303:751..867+ (Phaeothamnion wetherbeei SAG_119_79)back to top |