mRNA_P-wetherbeei_contig12273.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12273.2.1 vs. uniprot
Match: A0A517Y3I5_9BACT (Uncharacterized protein n=1 Tax=Urbifossiella limnaea TaxID=2528023 RepID=A0A517Y3I5_9BACT) HSP 1 Score: 52.4 bits (124), Expect = 9.580e-7 Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 4 SGEGEPLARNAAGYDHRCQIESVRRLFEVLNALREWE 114 SG GE L +NAAGYD R Q+ SVRRL EV++ L EWE Sbjct: 244 SGAGEVLRKNAAGYDQRAQVGSVRRLVEVIHRLVEWE 280 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12273.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12273.2.1 >prot_P-wetherbeei_contig12273.2.1 ID=prot_P-wetherbeei_contig12273.2.1|Name=mRNA_P-wetherbeei_contig12273.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=41bp MSGEGEPLARNAAGYDHRCQIESVRRLFEVLNALREWEAT*back to top mRNA from alignment at P-wetherbeei_contig12273:1862..1984- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12273.2.1 ID=mRNA_P-wetherbeei_contig12273.2.1|Name=mRNA_P-wetherbeei_contig12273.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig12273:1862..1984- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12273:1862..1984- >mRNA_P-wetherbeei_contig12273.2.1 ID=mRNA_P-wetherbeei_contig12273.2.1|Name=mRNA_P-wetherbeei_contig12273.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig12273:1862..1984- (Phaeothamnion wetherbeei SAG_119_79)back to top |