mRNA_P-wetherbeei_contig1208.5.3 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A7W0SFM7_9ACTN (PQQ-dependent sugar dehydrogenase n=1 Tax=Acidimicrobiia bacterium TaxID=2080302 RepID=A0A7W0SFM7_9ACTN) HSP 1 Score: 63.5 bits (153), Expect = 5.100e-9 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 3 Query: 147 RFSPCSDHMFLIDKSGNFIAESTVTDEL-TFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDDSCTLPP 389 RFSP +F+ +K G ++TD T + VY D G GM +HPNFPTTP+IY+ YT D Y +D+C PP Sbjct: 69 RFSP-DGRVFVAEKGGTVKVFDSLTDPTPTTAVDLSTEVYAYWDRGLLGMALHPNFPTTPYIYLLYTLDTHPY-NDACPTPP 148
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: UPI00069B450A (PA14 domain-containing protein n=1 Tax=Calothrix sp. 336/3 TaxID=1337936 RepID=UPI00069B450A) HSP 1 Score: 52.8 bits (125), Expect = 3.050e-5 Identity = 27/86 (31.40%), Postives = 44/86 (51.16%), Query Frame = 3 Query: 150 FSPCSDHMFLIDKSGNFIAESTVTDELTFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDD--SCTLPPDPEG 401 ++P MF+ K+G + T +T I V +V D G G+ +HPNF T P++Y+ +T DP +++ T DP+G Sbjct: 1407 WTPDGSRMFIAQKNGVVKVYNYATQAVTDFIDISAQVNDVRDRGLLGLAVHPNFSTNPYVYLGFTYDPPEAYNNINPNTNYDDPDG 1492
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A7W1N6C4_9ACTN (PQQ-dependent sugar dehydrogenase (Fragment) n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7W1N6C4_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 3.690e-5 Identity = 31/93 (33.33%), Postives = 45/93 (48.39%), Query Frame = 3 Query: 147 RFSPCSDHMFLIDKSGNFIAESTVTDELTFKFT-IKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADP-----ANYW------DDSCTLPP 389 RF+P +F+ +KSG + ++TD F ++ V+ D G GM++ P FPT P+IY+ YT D A W D C PP Sbjct: 68 RFAP-DGRIFVAEKSGMILEYDSLTDPTPTVFADLRTEVHNFWDRGLLGMVLDPQFPTRPYIYVLYTYDAPIGGTAPTWGVAGQDSDGCATPP 159
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Match: A0A517MN54_9BACT (Soluble aldose sugar dehydrogenase YliI n=1 Tax=Roseimaritima multifibrata TaxID=1930274 RepID=A0A517MN54_9BACT) HSP 1 Score: 51.6 bits (122), Expect = 7.600e-5 Identity = 26/93 (27.96%), Postives = 45/93 (48.39%), Query Frame = 3 Query: 96 TLGTSTLIPSGTRRMEARFSPCSDHMFLIDKSGNFIAESTVTDELTFKFTIKNMVYEVADHGPTGMLIHPNFPTTPFIYIYYTADPANYWDDS 374 TL TL + + ++P +M++ +KSG + T I+N V + D G + +HP+F P++Y+ YT DP +D+S Sbjct: 982 TLVGETLFAELNQPTDIDWNPDGTNMYISEKSGLIKVSRNGELQATPFVDIRNQVNDTRDRGLLDIAVHPDFENNPYVYLLYTYDPPEVYDNS 1074 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1208.5.3 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1208.5.3 >prot_P-wetherbeei_contig1208.5.3 ID=prot_P-wetherbeei_contig1208.5.3|Name=mRNA_P-wetherbeei_contig1208.5.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=135bp MRAFIGALGSALFFRDAGAATVISELFTLGTSTLIPSGTRRMEARFSPCSback to top mRNA from alignment at P-wetherbeei_contig1208:5386..6366- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1208.5.3 ID=mRNA_P-wetherbeei_contig1208.5.3|Name=mRNA_P-wetherbeei_contig1208.5.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=981bp|location=Sequence derived from alignment at P-wetherbeei_contig1208:5386..6366- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1208:5386..6366- >mRNA_P-wetherbeei_contig1208.5.3 ID=mRNA_P-wetherbeei_contig1208.5.3|Name=mRNA_P-wetherbeei_contig1208.5.3|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=405bp|location=Sequence derived from alignment at P-wetherbeei_contig1208:5386..6366- (Phaeothamnion wetherbeei SAG_119_79)back to top |