mRNA_P-wetherbeei_contig12015.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12015.1.1 vs. uniprot
Match: R7T7R2_CAPTE (Phosphatidate phosphatase n=1 Tax=Capitella teleta TaxID=283909 RepID=R7T7R2_CAPTE) HSP 1 Score: 53.5 bits (127), Expect = 5.720e-6 Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 1 Query: 28 VPGGPVLCTPEALLPRAHAPAPEAQ-KAFVTAALRGLAELFPQDANPLYAGFGSDAGQAAVLRRCGVPEGRVFACQG-GELRGGANRTFR 291 +P GP+L +P +L+ H E + + F + L+ +A LFP+ ANP YAGFG+ R G+P RVF GEL+ + TF+ Sbjct: 664 LPEGPLLLSPSSLMSAFHKEVIERKPEEFKISCLKNIAALFPESANPFYAGFGNKINDTWAYRAVGIPISRVFTVNHRGELKMEFHTTFQ 753 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12015.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12015.1.1 >prot_P-wetherbeei_contig12015.1.1 ID=prot_P-wetherbeei_contig12015.1.1|Name=mRNA_P-wetherbeei_contig12015.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=107bp MRPPLPAGGVPGGPVLCTPEALLPRAHAPAPEAQKAFVTAALRGLAELFPback to top mRNA from alignment at P-wetherbeei_contig12015:26..346- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12015.1.1 ID=mRNA_P-wetherbeei_contig12015.1.1|Name=mRNA_P-wetherbeei_contig12015.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=321bp|location=Sequence derived from alignment at P-wetherbeei_contig12015:26..346- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12015:26..346- >mRNA_P-wetherbeei_contig12015.1.1 ID=mRNA_P-wetherbeei_contig12015.1.1|Name=mRNA_P-wetherbeei_contig12015.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=321bp|location=Sequence derived from alignment at P-wetherbeei_contig12015:26..346- (Phaeothamnion wetherbeei SAG_119_79)back to top |