mRNA_P-wetherbeei_contig11981.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: R7YQU3_CONA1 (WSC domain-containing protein n=1 Tax=Coniosporium apollinis (strain CBS 100218) TaxID=1168221 RepID=R7YQU3_CONA1) HSP 1 Score: 57.0 bits (136), Expect = 5.350e-8 Identity = 29/58 (50.00%), Postives = 35/58 (60.34%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGS--LGFADVVDKAKMIRAETTCDLKGDFSNYWTPILY 171 E DPIVA G S+H H ISG GF DKA+ + ++C +K D SNYWTP LY Sbjct: 34 ERADPIVAPGKVSAHVHTISGGSGFGFEMTYDKARASKC-SSCPIKADLSNYWTPSLY 90
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A074VH27_9PEZI (WSC-domain-containing protein n=1 Tax=Aureobasidium melanogenum CBS 110374 TaxID=1043003 RepID=A0A074VH27_9PEZI) HSP 1 Score: 56.2 bits (134), Expect = 1.000e-7 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DPI++ G S H H ISG GF +D A ++ ++C +K D SNYWTP+LY Sbjct: 10 ERADPIISPGQVSGHTHTISGGNGFKFDMDYADARSSDCSSCPIKADLSNYWTPLLY 66
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A6A6U7E2_9PEZI (WSC-domain-containing protein n=1 Tax=Microthyrium microscopicum TaxID=703497 RepID=A0A6A6U7E2_9PEZI) HSP 1 Score: 56.2 bits (134), Expect = 1.000e-7 Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DPIVA G + H H I+G GF +D A+ + ++C +K DFSNYWTP LY Sbjct: 32 ERADPIVAPGQVAGHVHKIAGGSGFGFSMDYAQARSSSCSSCPIKEDFSNYWTPKLY 88
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A4U0XWU0_9PEZI (WSC domain-containing protein n=2 Tax=Cryomyces minteri TaxID=331657 RepID=A0A4U0XWU0_9PEZI) HSP 1 Score: 55.8 bits (133), Expect = 1.370e-7 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DP+V+ G S H H ISG GF +D A+ ++ ++C +K D SNYWTP LY Sbjct: 34 ERADPVVSPGVVSGHVHTISGGNGFGFTMDYAQARASQCSSCPIKEDLSNYWTPKLY 90
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A074Z9D4_AURSE (WSC domain-containing protein n=1 Tax=Aureobasidium subglaciale (strain EXF-2481) TaxID=1043005 RepID=A0A074Z9D4_AURSE) HSP 1 Score: 55.1 bits (131), Expect = 2.590e-7 Identity = 31/62 (50.00%), Postives = 36/62 (58.06%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE------TTCDLKGDFSNYWTPILY 171 E DPIVA G S H H ISGS GF KA+M A+ ++C +K D SNYWTP LY Sbjct: 35 ERLDPIVAPGGVSGHVHTISGSNGF-----KAEMTYADARGGACSSCPIKQDMSNYWTPALY 91
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A4S3JP40_9EURO (DUF1996 domain-containing protein n=1 Tax=Aspergillus tanneri TaxID=1220188 RepID=A0A4S3JP40_9EURO) HSP 1 Score: 54.7 bits (130), Expect = 3.460e-7 Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DPI+ G +SH H ISG GFA +D K ++ ++C +K D SNYWTP LY Sbjct: 36 ERADPIINPGAVASHVHTISGGNGFALSMDYDKARSSDCSSCPIKQDLSNYWTPKLY 92
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A6A6XM05_9PLEO (WSC-domain-containing protein n=1 Tax=Melanomma pulvis-pyrius CBS 109.77 TaxID=1314802 RepID=A0A6A6XM05_9PLEO) HSP 1 Score: 54.7 bits (130), Expect = 3.500e-7 Identity = 25/54 (46.30%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 13 DPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 DP+V+ G S H H ISG GF +D K ++ +TC +K D SNYW+P LY Sbjct: 34 DPLVSPGVASGHVHTISGGNGFNFTMDYQKARASQCSTCSIKQDLSNYWSPKLY 87
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A163CCZ5_DIDRA (WSC domain-containing protein n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163CCZ5_DIDRA) HSP 1 Score: 54.7 bits (130), Expect = 3.500e-7 Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DPI+ G +SH H ISG + FA + M A+ +TC +K D SNYWTP LY Sbjct: 31 ERLDPIINPGGVASHVHTISGGVAFAPTMTYQDMQAAKCSTCTIKEDMSNYWTPQLY 87
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: A0A232M6X1_9EURO (WSC domain-containing protein n=1 Tax=Elaphomyces granulatus TaxID=519963 RepID=A0A232M6X1_9EURO) HSP 1 Score: 54.7 bits (130), Expect = 3.520e-7 Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 1 Query: 4 ESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 E DPIV G S H H I+G GF +D A+ ++ ++C +K D SNYWTP LY Sbjct: 35 ERADPIVGPGQVSGHVHTIAGGSGFTFTMDYAQARSSKCSSCPIKQDLSNYWTPSLY 91
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Match: UPI00144AB2D1 (WSC-domain-containing protein n=1 Tax=Lindgomyces ingoldianus TaxID=673940 RepID=UPI00144AB2D1) HSP 1 Score: 54.3 bits (129), Expect = 4.780e-7 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 13 DPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAE-TTCDLKGDFSNYWTPILY 171 DP+V+ G +SH H ISG GF +D K ++ +TC++K D SNYW+P LY Sbjct: 34 DPVVSPGVAASHVHTISGGNGFNFSMDYNKARASKCSTCNIKQDLSNYWSPKLY 87 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11981.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11981.1.1 >prot_P-wetherbeei_contig11981.1.1 ID=prot_P-wetherbeei_contig11981.1.1|Name=mRNA_P-wetherbeei_contig11981.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=59bp IESQDPIVAAGTRSSHPHHISGSLGFADVVDKAKMIRAETTCDLKGDFSNback to top mRNA from alignment at P-wetherbeei_contig11981:333..509- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11981.1.1 ID=mRNA_P-wetherbeei_contig11981.1.1|Name=mRNA_P-wetherbeei_contig11981.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=177bp|location=Sequence derived from alignment at P-wetherbeei_contig11981:333..509- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11981:333..509- >mRNA_P-wetherbeei_contig11981.1.1 ID=mRNA_P-wetherbeei_contig11981.1.1|Name=mRNA_P-wetherbeei_contig11981.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=177bp|location=Sequence derived from alignment at P-wetherbeei_contig11981:333..509- (Phaeothamnion wetherbeei SAG_119_79)back to top |