mRNA_P-wetherbeei_contig11862.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A0C2ZHK6_9AGAM (Bromo domain-containing protein (Fragment) n=1 Tax=Scleroderma citrinum Foug A TaxID=1036808 RepID=A0A0C2ZHK6_9AGAM) HSP 1 Score: 57.4 bits (137), Expect = 8.220e-8 Identity = 23/57 (40.35%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 ++I P+ +ST+ +R++A Y S + F DWKL+ DN + NQEGS + +DA++M++ Sbjct: 8 QLITHPIALSTLRKRISANYYKSISHFRDDWKLMFDNVRTHNQEGSWVYVDAEEMEK 64
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A0C9YW66_9AGAM (Unplaced genomic scaffold scaffold_256, whole genome shotgun sequence n=1 Tax=Pisolithus microcarpus 441 TaxID=765257 RepID=A0A0C9YW66_9AGAM) HSP 1 Score: 60.8 bits (146), Expect = 3.260e-7 Identity = 24/57 (42.11%), Postives = 43/57 (75.44%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 ++I +P+ +ST+ +R+ A Y S QF++DWKL+ DN + +NQEGS + +DA++M++ Sbjct: 1242 QLITQPIALSTLRKRMNAGYYKSITQFKEDWKLMFDNARTYNQEGSWVYVDAEEMEK 1298
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: V9KKV6_CALMI (Cat eye syndrome critical region protein 2-like protein (Fragment) n=2 Tax=Callorhinchus milii TaxID=7868 RepID=V9KKV6_CALMI) HSP 1 Score: 59.7 bits (143), Expect = 7.220e-7 Identity = 28/72 (38.89%), Postives = 48/72 (66.67%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDRCCLLLSVRSVFRYVP 282 ++I++PM++STIE L A+QY+S F D+KL+ +NC+K+N G+ L A+ ++RC ++V +Y P Sbjct: 512 KIIKEPMDLSTIERMLNAKQYNSKWTFISDFKLMFENCEKYNGRGNEYTLMARTVERCFN----KAVVKYFP 579
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A4W3JW74_CALMI (Bromo domain-containing protein n=6 Tax=Callorhinchus milii TaxID=7868 RepID=A0A4W3JW74_CALMI) HSP 1 Score: 59.7 bits (143), Expect = 8.050e-7 Identity = 28/72 (38.89%), Postives = 48/72 (66.67%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDRCCLLLSVRSVFRYVP 282 ++I++PM++STIE L A+QY+S F D+KL+ +NC+K+N G+ L A+ ++RC ++V +Y P Sbjct: 434 KIIKEPMDLSTIERMLNAKQYNSKWTFISDFKLMFENCEKYNGRGNEYTLMARTVERCFN----KAVVKYFP 501
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A4R0RFM2_9APHY (Uncharacterized protein n=1 Tax=Steccherinum ochraceum TaxID=92696 RepID=A0A4R0RFM2_9APHY) HSP 1 Score: 59.7 bits (143), Expect = 8.090e-7 Identity = 25/71 (35.21%), Postives = 47/71 (66.20%), Query Frame = 1 Query: 49 FRSVPRR--------MIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 FR VP + +I++P+ ++T+ +R+ + Y S FEKDW+L+ +N + +NQEGS + +DA++M++ Sbjct: 1335 FREVPDKREYPDYYQLIKQPIALATLRKRIGSNYYKSVTDFEKDWRLMFNNARTYNQEGSWVYVDAEEMEK 1405
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A0C9ZT36_9AGAM (Bromo domain-containing protein n=1 Tax=Suillus luteus UH-Slu-Lm8-n1 TaxID=930992 RepID=A0A0C9ZT36_9AGAM) HSP 1 Score: 55.8 bits (133), Expect = 1.230e-6 Identity = 22/53 (41.51%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 79 KPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 +P+ +ST+ +R A Y S Q+++DWKL+ DN + +NQEGS + +DA++M++ Sbjct: 1 RPIALSTLRKRGNAGYYKSITQYKEDWKLMFDNARTYNQEGSWVYIDAEEMEK 53
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A0C2ZC83_9AGAM (Uncharacterized protein n=1 Tax=Scleroderma citrinum Foug A TaxID=1036808 RepID=A0A0C2ZC83_9AGAM) HSP 1 Score: 58.9 bits (141), Expect = 1.470e-6 Identity = 23/57 (40.35%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 ++I P+ +ST+ +R+ A Y S + F DWKL+ DN + +NQEGS + +DA++M++ Sbjct: 1298 QLITHPIALSTLRKRIGANYYKSISHFRDDWKLMFDNARTYNQEGSWVYVDAEEMEK 1354
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A0C9W1M9_9AGAM (Uncharacterized protein n=1 Tax=Hydnomerulius pinastri MD-312 TaxID=994086 RepID=A0A0C9W1M9_9AGAM) HSP 1 Score: 58.9 bits (141), Expect = 1.470e-6 Identity = 23/57 (40.35%), Postives = 42/57 (73.68%), Query Frame = 1 Query: 67 RMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 ++I +P+ +STI +R+ Y S Q+++DWKL+ DN + +NQEGS + +DA++M++ Sbjct: 1318 QLITQPIALSTIRKRVNTGYYKSVTQYKEDWKLMFDNARTYNQEGSWVYIDAEEMEK 1374
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: J9JMN1_ACYPI (Uncharacterized protein n=29 Tax=Aphididae TaxID=27482 RepID=J9JMN1_ACYPI) HSP 1 Score: 58.9 bits (141), Expect = 1.490e-6 Identity = 29/82 (35.37%), Postives = 51/82 (62.20%), Query Frame = 1 Query: 1 PLCLFPGVPATLLLPPFRSVPRRMIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDRCCL 246 P+ +F +P+ L P + V I +P+++ TIEE++ +Y S + +D+KL+ DNC++FN+EGS I DA +++ L Sbjct: 526 PMLMFMEIPSKKLYPAYYKV----ISEPIDMLTIEEKIKQEKYKSEDEILQDFKLMFDNCRQFNEEGSLIYEDANTLEKVLL 603
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Match: A0A2G5B856_COERN (Bromodomain-containing protein (Fragment) n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5B856_COERN) HSP 1 Score: 53.9 bits (128), Expect = 2.500e-6 Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1 Query: 70 MIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDAQDMDR 237 +IR+P+ I TI + A +Y+S A F DWKL+ DN + +N+EGS + DA + R Sbjct: 16 IIRQPIAIKTIRRNVKAHKYASVAAFHHDWKLMFDNARTYNEEGSMVYNDACALQR 71 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11862.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11862.1.1 >prot_P-wetherbeei_contig11862.1.1 ID=prot_P-wetherbeei_contig11862.1.1|Name=mRNA_P-wetherbeei_contig11862.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=74bp MIRKPMEISTIEERLAARQYSSSAQFEKDWKLIIDNCKKFNQEGSSICLDback to top mRNA from alignment at P-wetherbeei_contig11862:359..1005- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11862.1.1 ID=mRNA_P-wetherbeei_contig11862.1.1|Name=mRNA_P-wetherbeei_contig11862.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=647bp|location=Sequence derived from alignment at P-wetherbeei_contig11862:359..1005- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11862:359..1005- >mRNA_P-wetherbeei_contig11862.1.1 ID=mRNA_P-wetherbeei_contig11862.1.1|Name=mRNA_P-wetherbeei_contig11862.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=222bp|location=Sequence derived from alignment at P-wetherbeei_contig11862:359..1005- (Phaeothamnion wetherbeei SAG_119_79)back to top |