mRNA_P-wetherbeei_contig11851.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A6H5KJM3_9PHAE (Anaphase-promoting complex subunit 2 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJM3_9PHAE) HSP 1 Score: 82.4 bits (202), Expect = 8.840e-14 Identity = 41/84 (48.81%), Postives = 57/84 (67.86%), Query Frame = 3 Query: 15 EEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHL 266 E+ A +S+ A AE+D ++ ++L GML N +LP ++IHN LKMFMS G+ KY++S+PEL Q L RL GKLEQ +Y L Sbjct: 380 EDNTEAAVSADANDAESDKIIVQFLTGMLTNFSKLPLDRIHNNLKMFMSGGDNKYDKSLPELQQLLWRLCSDGKLEQADGEYRL 463
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: D8LNH8_ECTSI (Anaphase-promoting complex subunit 2 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNH8_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 1.280e-13 Identity = 40/84 (47.62%), Postives = 56/84 (66.67%), Query Frame = 3 Query: 15 EEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHL 266 E+ A +S+ A AE+D ++ ++L GML N +LP ++IHN LKMFMS G+ KY++S+PEL Q L RL GKLE +Y L Sbjct: 211 EDNTEAAVSADANDAESDKIIVQFLTGMLTNFSKLPLDRIHNNLKMFMSGGDNKYDKSLPELQQLLWRLCSDGKLEHADGEYRL 294
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A7S0GLJ3_9STRA (Anaphase-promoting complex subunit 2 n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0GLJ3_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 1.490e-9 Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 3 Query: 6 EEEEEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLE 242 EEE E +A +++SA +AE V E Y+ GML+NLG+LP E+IHN+LKMF+S + KY+++ +L L++L + KLE Sbjct: 371 EEESEDQQAKVAASAQLAEEMKVYESYVVGMLSNLGQLPLERIHNMLKMFVSGSDHKYDKTPQQLSVLLQKLCKEDKLE 449
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A7S0FHF1_9STRA (Anaphase-promoting complex subunit 2 n=1 Tax=Minutocellus polymorphus TaxID=265543 RepID=A0A7S0FHF1_9STRA) HSP 1 Score: 66.6 bits (161), Expect = 5.090e-9 Identity = 36/77 (46.75%), Postives = 51/77 (66.23%), Query Frame = 3 Query: 12 EEEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLE 242 E++G LS+ A AE V E Y+ GMLANLG+LP ++IHN LKMF S + KY+++ +L FL++L + KLE Sbjct: 165 EDDGEEQALSARAQQAEEMQVYESYIFGMLANLGQLPLDRIHNNLKMFASGSDHKYDKTARQLSSFLQKLCKEEKLE 241
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A7S2WK46_9STRA (Hypothetical protein (Fragment) n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2WK46_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 1.290e-8 Identity = 34/77 (44.16%), Postives = 49/77 (63.64%), Query Frame = 3 Query: 12 EEEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLE 242 ++EG +S A E V E Y+ GML+NLG+LP E+IHN+LKMF++ E KY ++ +L FL++L KLE Sbjct: 46 DDEGEGLAVSLGAEQEEEMQVYESYISGMLSNLGQLPLERIHNMLKMFVTGSEHKYNKTPQQLSIFLQQLCKDEKLE 122
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A7R9ZKL6_9STRA (Anaphase-promoting complex subunit 2 n=1 Tax=Craspedostauros australis TaxID=1486917 RepID=A0A7R9ZKL6_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 4.740e-8 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 3 Query: 36 LSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLE 242 +S+SA E V E Y+ GML NLG+LP ++IHN+LK F++ + KY ++ +L QFL+RL Q KLE Sbjct: 267 VSASAQEEEEMQVYESYIFGMLTNLGQLPLDRIHNMLKTFVAGSDVKYNKTPQQLAQFLQRLCKQEKLE 335
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A2R5GKM1_9STRA (Anaphase-promoting complex subunit 2 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GKM1_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 8.800e-8 Identity = 35/77 (45.45%), Postives = 48/77 (62.34%), Query Frame = 3 Query: 36 LSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHL 266 +S+ A +AE V E +++GML N L E+IHN+LKMF+S GE KYE+++ EL FL +L LE T Y L Sbjct: 728 VSADAQLAEEMKVYESFVRGMLNNYDALTLERIHNMLKMFVSTGEHKYEKNINELEAFLDKLVKDEVLEVTNGSYFL 804
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A7S2SKH5_9STRA (Anaphase-promoting complex subunit 2 n=1 Tax=labyrinthulid quahog parasite QPX TaxID=96639 RepID=A0A7S2SKH5_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 2.080e-6 Identity = 33/88 (37.50%), Postives = 53/88 (60.23%), Query Frame = 3 Query: 3 GEEEEEGGRAGLSSSAAVAEADAVMERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHL 266 G ++E+ +S+ A + V E +++GML N LP ++IHN+LKMF+S GE KY++++ +L FL +L LE + A Y L Sbjct: 706 GAQDEDATERAVSADAQLEAEMKVYESFVRGMLNNYESLPLDRIHNMLKMFVSTGEHKYDKNVQQLGAFLDKLVRDDVLEFSNAGYFL 793
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: A0A8B7DER5_HYDVU (Anaphase-promoting complex subunit 2 n=1 Tax=Hydra vulgaris TaxID=6087 RepID=A0A8B7DER5_HYDVU) HSP 1 Score: 58.9 bits (141), Expect = 2.540e-6 Identity = 29/65 (44.62%), Postives = 38/65 (58.46%), Query Frame = 3 Query: 84 YLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHLPPPA 278 Y+ GML N+G LP E+IH++LKMF +HGE S+ E+ FL G+L G Y LP A Sbjct: 208 YVVGMLTNIGSLPLERIHSMLKMFATHGESSSHCSLEEVKAFLCSKINDGELTYVGGMYKLPKGA 272
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Match: T2M430_HYDVU (Anaphase-promoting complex subunit 2 n=2 Tax=Hydra vulgaris TaxID=6087 RepID=T2M430_HYDVU) HSP 1 Score: 58.9 bits (141), Expect = 6.290e-6 Identity = 29/65 (44.62%), Postives = 38/65 (58.46%), Query Frame = 3 Query: 84 YLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAGQGKLEQTGADYHLPPPA 278 Y+ GML N+G LP E+IH++LKMF +HGE S+ E+ FL G+L G Y LP A Sbjct: 646 YVVGMLTNIGSLPLERIHSMLKMFATHGESSSHCSLEEVKAFLCSKINDGELTYVGGMYKLPKGA 710 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11851.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 18
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11851.1.1 >prot_P-wetherbeei_contig11851.1.1 ID=prot_P-wetherbeei_contig11851.1.1|Name=mRNA_P-wetherbeei_contig11851.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=76bp MERYLKGMLANLGRLPAEKIHNLLKMFMSHGEQKYERSMPELVQFLRRLAback to top mRNA from alignment at P-wetherbeei_contig11851:63..1051+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11851.1.1 ID=mRNA_P-wetherbeei_contig11851.1.1|Name=mRNA_P-wetherbeei_contig11851.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=989bp|location=Sequence derived from alignment at P-wetherbeei_contig11851:63..1051+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11851:63..1051+ >mRNA_P-wetherbeei_contig11851.1.1 ID=mRNA_P-wetherbeei_contig11851.1.1|Name=mRNA_P-wetherbeei_contig11851.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=228bp|location=Sequence derived from alignment at P-wetherbeei_contig11851:63..1051+ (Phaeothamnion wetherbeei SAG_119_79)back to top |