mRNA_P-wetherbeei_contig11847.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A5A8C932_CAFRO (Kinesin motor domain-containing protein n=4 Tax=Sar TaxID=2698737 RepID=A0A5A8C932_CAFRO) HSP 1 Score: 90.5 bits (223), Expect = 5.350e-20 Identity = 41/48 (85.42%), Postives = 46/48 (95.83%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRA 144 +VFED +RLVQSAFDGFNVCIFAYGQTGSGKTFTMSG+ D+PG+TPRA Sbjct: 1244 EVFEDTERLVQSAFDGFNVCIFAYGQTGSGKTFTMSGSPDMPGITPRA 1291
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A5A8CJI1_CAFRO (Kinesin motor domain-containing protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CJI1_CAFRO) HSP 1 Score: 90.5 bits (223), Expect = 5.350e-20 Identity = 41/48 (85.42%), Postives = 46/48 (95.83%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRA 144 +VFED +RLVQSAFDGFNVCIFAYGQTGSGKTFTMSG+ D+PG+TPRA Sbjct: 1094 EVFEDTERLVQSAFDGFNVCIFAYGQTGSGKTFTMSGSPDMPGITPRA 1141
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A836C7Z6_9STRA (Kinesin-like protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C7Z6_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 3.980e-18 Identity = 38/47 (80.85%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPR 141 +VFED K LV+SA DGFNVC+FAYGQTGSGKTFTMSGT ++PGLTPR Sbjct: 60 EVFEDMKNLVRSAMDGFNVCVFAYGQTGSGKTFTMSGTPEMPGLTPR 106
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A7S0SVK5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0SVK5_9STRA) HSP 1 Score: 81.3 bits (199), Expect = 5.880e-18 Identity = 37/47 (78.72%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPR 141 +VFE+A+RLV+S DGFNVCIFAYGQTGSGKTFTM+GT + PGLTPR Sbjct: 142 QVFEEAQRLVESFLDGFNVCIFAYGQTGSGKTFTMTGTPESPGLTPR 188
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A482SJC9_9ARCH (Kinesin motor domain-containing protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SJC9_9ARCH) HSP 1 Score: 84.3 bits (207), Expect = 6.280e-18 Identity = 37/48 (77.08%), Postives = 44/48 (91.67%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRA 144 +VFED KRLV+S DGFNVC+FAYGQTGSGKTFTM+G+S +PGLTP+A Sbjct: 178 QVFEDTKRLVESCMDGFNVCLFAYGQTGSGKTFTMTGSSSMPGLTPKA 225
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: K3W8F7_GLOUD (Kinesin motor domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3W8F7_GLOUD) HSP 1 Score: 84.0 bits (206), Expect = 1.070e-17 Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRA 144 +VFED K L+QSA DGFNVCIFAYGQTGSGKTFTM+GT +PGL+PRA Sbjct: 1322 QVFEDTKNLLQSALDGFNVCIFAYGQTGSGKTFTMTGTETMPGLSPRA 1369
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A8K1CB49_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CB49_PYTOL) HSP 1 Score: 84.0 bits (206), Expect = 1.070e-17 Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRA 144 +VFED K L+QSA DG+NVCIFAYGQTGSGKTFTM+G+ LPGLTPRA Sbjct: 1139 EVFEDTKNLLQSAIDGYNVCIFAYGQTGSGKTFTMTGSESLPGLTPRA 1186
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A067BRV6_SAPPC (Kinesin-like protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067BRV6_SAPPC) HSP 1 Score: 83.2 bits (204), Expect = 1.250e-17 Identity = 37/47 (78.72%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPR 141 +VFED K L+QSA DG+NVCIFAYGQTGSGKTFTM+GT+D PG+TPR Sbjct: 60 QVFEDTKNLLQSALDGYNVCIFAYGQTGSGKTFTMTGTADHPGITPR 106
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: A0A5J4Y890_9CHLO (Kinesin-like calmodulin-binding protein n=1 Tax=Trebouxia sp. A1-2 TaxID=2608996 RepID=A0A5J4Y890_9CHLO) HSP 1 Score: 83.2 bits (204), Expect = 1.990e-17 Identity = 39/47 (82.98%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPR 141 KVFED K LVQSA DG+NVCIFAYGQTGSGKTFT+ GT D PGLTPR Sbjct: 963 KVFEDTKHLVQSAVDGYNVCIFAYGQTGSGKTFTIYGTDDNPGLTPR 1009
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Match: T0QAH1_SAPDV (Kinesin motor domain-containing protein n=2 Tax=Saprolegnia diclina (strain VS20) TaxID=1156394 RepID=T0QAH1_SAPDV) HSP 1 Score: 83.2 bits (204), Expect = 2.000e-17 Identity = 37/47 (78.72%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPR 141 +VFED K L+QSA DG+NVCIFAYGQTGSGKTFTM+GT+D PG+TPR Sbjct: 1069 QVFEDTKNLLQSALDGYNVCIFAYGQTGSGKTFTMTGTADHPGITPR 1115 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11847.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11847.1.1 >prot_P-wetherbeei_contig11847.1.1 ID=prot_P-wetherbeei_contig11847.1.1|Name=mRNA_P-wetherbeei_contig11847.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=48bp KVFEDAKRLVQSAFDGFNVCIFAYGQTGSGKTFTMSGTSDLPGLTPRAback to top mRNA from alignment at P-wetherbeei_contig11847:1761..1904+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11847.1.1 ID=mRNA_P-wetherbeei_contig11847.1.1|Name=mRNA_P-wetherbeei_contig11847.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig11847:1761..1904+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11847:1761..1904+ >mRNA_P-wetherbeei_contig11847.1.1 ID=mRNA_P-wetherbeei_contig11847.1.1|Name=mRNA_P-wetherbeei_contig11847.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=144bp|location=Sequence derived from alignment at P-wetherbeei_contig11847:1761..1904+ (Phaeothamnion wetherbeei SAG_119_79)back to top |