mRNA_P-wetherbeei_contig11831.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A4Q3V8E3_9BURK (PhoD domain-containing protein n=1 Tax=Burkholderiales bacterium TaxID=1891238 RepID=A0A4Q3V8E3_9BURK) HSP 1 Score: 77.0 bits (188), Expect = 9.530e-16 Identity = 38/54 (70.37%), Postives = 42/54 (77.78%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KFVNRQRGYMVCDVTPER ETS LDKVSV DGKL+ R L V +GSN ++ A Sbjct: 193 KFVNRQRGYMVCDVTPERSETSAMSLDKVSVADGKLTKRATLTVPRGSNTLSVA 246
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A2D7ZP22_9CAUL (PhoD domain-containing protein n=1 Tax=Phenylobacterium sp. TaxID=1871053 RepID=A0A2D7ZP22_9CAUL) HSP 1 Score: 68.9 bits (167), Expect = 2.070e-13 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KF N QRGY++C+VTPER+E + R++DKVS P G +STR KLAV G VV A Sbjct: 94 KFNNSQRGYLLCEVTPERFEAAFRVIDKVSAPGGTVSTRAKLAVPAGEAVVVPA 147
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A7W6JEW5_9CAUL (Alkaline phosphatase D n=1 Tax=Brevundimonas lenta TaxID=424796 RepID=A0A7W6JEW5_9CAUL) HSP 1 Score: 72.0 bits (175), Expect = 2.290e-13 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KF N QRGY+VCDVTPERW+T ++LDKVS G L+TR KLAVA G + AA Sbjct: 470 KFNNAQRGYVVCDVTPERWQTEFKVLDKVSERGGTLTTRAKLAVASGDARIVAA 523
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A7X6BNM9_9CAUL (Alkaline phosphatase D n=1 Tax=Brevundimonas alba TaxID=74314 RepID=A0A7X6BNM9_9CAUL) HSP 1 Score: 71.2 bits (173), Expect = 4.280e-13 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQG 141 KF N QRGY+VCDVTPERW+T ++LDKVS DG L+TR LAVA G Sbjct: 470 KFNNAQRGYVVCDVTPERWQTEFKVLDKVSEKDGTLTTRATLAVASG 516
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A519L146_9CAUL (Alkaline phosphatase (Fragment) n=1 Tax=Brevundimonas sp. TaxID=1871086 RepID=A0A519L146_9CAUL) HSP 1 Score: 68.9 bits (167), Expect = 6.000e-13 Identity = 33/54 (61.11%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KF N QRGY VCDVTP+ W T ++LDKVS P G LSTR AV +GS+ V AA Sbjct: 150 KFNNAQRGYAVCDVTPDTWRTEFKVLDKVSEPGGTLSTRATYAVERGSSRVVAA 203
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: UPI001411BA24 (alkaline phosphatase D family protein n=1 Tax=Rhizobium sp. CRIBSB TaxID=2683264 RepID=UPI001411BA24) HSP 1 Score: 70.5 bits (171), Expect = 7.900e-13 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQG 141 KF N QRGY+VCDVTPERW+T ++LDKVS G L+TR KLAVA G Sbjct: 406 KFNNAQRGYVVCDVTPERWQTEFKVLDKVSERGGTLTTRAKLAVASG 452
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A519QLW7_9CAUL (Alkaline phosphatase n=1 Tax=Brevundimonas sp. TaxID=1871086 RepID=A0A519QLW7_9CAUL) HSP 1 Score: 70.5 bits (171), Expect = 8.000e-13 Identity = 34/54 (62.96%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KF N QRGY VCDVTPE W T+ ++LDKVS P G LSTR AV +GS+ V AA Sbjct: 465 KFNNAQRGYAVCDVTPETWRTAFKVLDKVSEPGGTLSTRATYAVERGSSRVVAA 518
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: UPI001C6308CE (alkaline phosphatase D family protein n=1 Tax=Brevundimonas sp. PAMC22021 TaxID=2861285 RepID=UPI001C6308CE) HSP 1 Score: 70.5 bits (171), Expect = 8.000e-13 Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQG 141 KF+N QRGY+VCDVT ERW+T ++LDKVS DG LSTR LA+A G Sbjct: 467 KFINSQRGYVVCDVTAERWQTEFKVLDKVSEKDGVLSTRKTLAIASG 513
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: A0A7W8HYL2_9CAUL (Alkaline phosphatase D n=1 Tax=Brevundimonas basaltis TaxID=472166 RepID=A0A7W8HYL2_9CAUL) HSP 1 Score: 70.5 bits (171), Expect = 8.000e-13 Identity = 32/47 (68.09%), Postives = 36/47 (76.60%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQG 141 KF N QRGY+VCDVTPERW+T ++LDKVS G LSTR K AVA G Sbjct: 469 KFNNAQRGYVVCDVTPERWQTEFKVLDKVSEKGGTLSTRAKFAVANG 515
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Match: UPI00083327AF (alkaline phosphatase D family protein n=1 Tax=Sphingomonas sp. CCH10-B3 TaxID=1768757 RepID=UPI00083327AF) HSP 1 Score: 70.5 bits (171), Expect = 8.010e-13 Identity = 33/54 (61.11%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 KFVNRQRGYMVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA 162 KF N QRGY+VCDVT ERW++ R+LDK+S P G L+TR KLAVA G + AA Sbjct: 478 KFNNAQRGYVVCDVTRERWQSEFRVLDKISAPGGVLTTRIKLAVAAGEPKLVAA 531 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11831.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11831.1.1 >prot_P-wetherbeei_contig11831.1.1 ID=prot_P-wetherbeei_contig11831.1.1|Name=mRNA_P-wetherbeei_contig11831.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=46bp MVCDVTPERWETSVRILDKVSVPDGKLSTRTKLAVAQGSNVVTAA*back to top mRNA from alignment at P-wetherbeei_contig11831:2..166+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11831.1.1 ID=mRNA_P-wetherbeei_contig11831.1.1|Name=mRNA_P-wetherbeei_contig11831.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=165bp|location=Sequence derived from alignment at P-wetherbeei_contig11831:2..166+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11831:2..166+ >mRNA_P-wetherbeei_contig11831.1.1 ID=mRNA_P-wetherbeei_contig11831.1.1|Name=mRNA_P-wetherbeei_contig11831.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=138bp|location=Sequence derived from alignment at P-wetherbeei_contig11831:2..166+ (Phaeothamnion wetherbeei SAG_119_79)back to top |