mRNA_P-wetherbeei_contig11720.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Match: UPI001BAA0D15 (transglycosylase SLT domain-containing protein n=1 Tax=Saccharopolyspora erythraea TaxID=1836 RepID=UPI001BAA0D15) HSP 1 Score: 62.4 bits (150), Expect = 3.610e-10 Identity = 33/68 (48.53%), Postives = 45/68 (66.18%), Query Frame = 1 Query: 4 VAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKGGELGSLSPQQAFNPHTNA 207 + VA+Q GVDP A+A+ ES + R +GD TSFGL+QLH+GG+LG+ +P+ AFNP NA Sbjct: 8 ITSVAQQHGVDPILALATAYQESKLNPRAVGD-----NGTSFGLYQLHRGGQLGNHTPEWAFNPANNA 70
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Match: A0A3S0CYM9_9BACT (SLT domain-containing protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A3S0CYM9_9BACT) HSP 1 Score: 60.1 bits (144), Expect = 5.670e-10 Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 1 Query: 1 IVAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKGGELGSLSPQQAFNPHTNAE 210 +VAE+A++ GVDPATAVA ML ESGG+ + +GD N H S GLFQL+ GE +S + +P NAE Sbjct: 1 MVAEIAKKDGVDPATAVADMLVESGGNNKAIGD-NGH----SVGLFQLNDQGEGAGMSVAERQDPTRNAE 65
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Match: A0A3S0EZ64_9BACT (Uncharacterized protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A3S0EZ64_9BACT) HSP 1 Score: 59.7 bits (143), Expect = 9.460e-9 Identity = 34/69 (49.28%), Postives = 43/69 (62.32%), Query Frame = 1 Query: 4 VAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKGGELGSLSPQQAFNPHTNAE 210 V EVA++KG+DP AVA+ML ESGGD + +GD S GLFQL+ GE +S Q +P NAE Sbjct: 273 VMEVAKEKGIDPTLAVATMLVESGGDNKAVGDGGH-----SIGLFQLNDNGEGSGMSVAQREDPRLNAE 336
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Match: UPI00082D4071 (transglycosylase SLT domain-containing protein n=1 Tax=Alicyclobacillus shizuokensis TaxID=392014 RepID=UPI00082D4071) HSP 1 Score: 53.5 bits (127), Expect = 1.010e-6 Identity = 34/71 (47.89%), Postives = 41/71 (57.75%), Query Frame = 1 Query: 1 IVAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKGGELGS-LSPQQAFNPHTNAE 210 IV++VA G+ P A+ M ESGG+ +GD TSFGLFQLHKGG G S Q +P TNAE Sbjct: 8 IVSQVALANGLPPWVALDIMAVESGGNPNAVGD-----NGTSFGLFQLHKGGGQGDGYSVSQLLDPLTNAE 73
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Match: UPI000834460F (transglycosylase SLT domain-containing protein n=1 Tax=Alicyclobacillus kakegawensis TaxID=392012 RepID=UPI000834460F) HSP 1 Score: 51.6 bits (122), Expect = 5.070e-6 Identity = 33/71 (46.48%), Postives = 41/71 (57.75%), Query Frame = 1 Query: 1 IVAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKGGELGS-LSPQQAFNPHTNAE 210 IV++VA G+ P A+ M ESGG+ +GD TSFGLFQLHKGG G S Q +P TNA+ Sbjct: 8 IVSQVALAYGLPPWVALDIMAVESGGNPNAVGD-----NGTSFGLFQLHKGGGQGDGYSVSQLLDPLTNAQ 73 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11720.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11720.2.1 >prot_P-wetherbeei_contig11720.2.1 ID=prot_P-wetherbeei_contig11720.2.1|Name=mRNA_P-wetherbeei_contig11720.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=70bp IVAEVARQKGVDPATAVASMLAESGGDARKLGDYNKHHQATSFGLFQLHKback to top mRNA from alignment at P-wetherbeei_contig11720:1894..2103+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11720.2.1 ID=mRNA_P-wetherbeei_contig11720.2.1|Name=mRNA_P-wetherbeei_contig11720.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=210bp|location=Sequence derived from alignment at P-wetherbeei_contig11720:1894..2103+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11720:1894..2103+ >mRNA_P-wetherbeei_contig11720.2.1 ID=mRNA_P-wetherbeei_contig11720.2.1|Name=mRNA_P-wetherbeei_contig11720.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=210bp|location=Sequence derived from alignment at P-wetherbeei_contig11720:1894..2103+ (Phaeothamnion wetherbeei SAG_119_79)back to top |