mRNA_P-wetherbeei_contig1165.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Match: V4SIZ9_CITCL (Oxidoreductase-like domain-containing protein n=4 Tax=Citrus TaxID=2706 RepID=V4SIZ9_CITCL) HSP 1 Score: 53.1 bits (126), Expect = 2.630e-5 Identity = 23/61 (37.70%), Postives = 38/61 (62.30%), Query Frame = 2 Query: 344 REPASEEGLSAVKGHQERSTHPTTLAKPQEPDASACCGNGCSKCVWIMYWAELNAWEAIQK 526 REP EE + +K +++ST P++P+ CCG+GC +CVW +Y+ EL A++ + K Sbjct: 77 REPVKEENIK-IKEEEQKSTK-MLPPPPEKPEPGDCCGSGCVRCVWDVYYEELEAYDKLYK 135 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1165.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1165.2.1 >prot_P-wetherbeei_contig1165.2.1 ID=prot_P-wetherbeei_contig1165.2.1|Name=mRNA_P-wetherbeei_contig1165.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=140bp MTTKAFGAARLCRRQLWKVGKRRLTSTAGEDDQSRLTASMDAFYELEQRIback to top mRNA from alignment at P-wetherbeei_contig1165:6329..7062+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1165.2.1 ID=mRNA_P-wetherbeei_contig1165.2.1|Name=mRNA_P-wetherbeei_contig1165.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=734bp|location=Sequence derived from alignment at P-wetherbeei_contig1165:6329..7062+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1165:6329..7062+ >mRNA_P-wetherbeei_contig1165.2.1 ID=mRNA_P-wetherbeei_contig1165.2.1|Name=mRNA_P-wetherbeei_contig1165.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=420bp|location=Sequence derived from alignment at P-wetherbeei_contig1165:6329..7062+ (Phaeothamnion wetherbeei SAG_119_79)back to top |