mRNA_P-wetherbeei_contig116.2.2 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A699YXE3_HAELA (WD_REPEATS_REGION domain-containing protein n=1 Tax=Haematococcus lacustris TaxID=44745 RepID=A0A699YXE3_HAELA) HSP 1 Score: 80.5 bits (197), Expect = 7.750e-14 Identity = 33/53 (62.26%), Postives = 44/53 (83.02%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLVGH 306 DP LER+FRGH+D VT+V F+++ KQL+S S DGC+M+W+F+PQLRA R GH Sbjct: 5 DPTLERSFRGHKDAVTSVCFNNNMKQLISGSLDGCVMIWNFKPQLRAYRFAGH 57
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A482SC39_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482SC39_9ARCH) HSP 1 Score: 75.1 bits (183), Expect = 2.920e-13 Identity = 34/57 (59.65%), Postives = 42/57 (73.68%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLVGHTAAV 318 DP LERTF+GH+ VT+VSFS KQL S S D +MLW+F+PQLRA R VGH ++ Sbjct: 13 DPSLERTFKGHKSYVTSVSFSPTLKQLASGSGDNNVMLWNFKPQLRAFRFVGHKVSI 69
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: D8UD37_VOLCA (Uncharacterized protein (Fragment) n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8UD37_VOLCA) HSP 1 Score: 82.4 bits (202), Expect = 4.780e-13 Identity = 35/56 (62.50%), Postives = 45/56 (80.36%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLVGHTAA 315 DP LER+FRGH+D VT+V F+H+ KQLVS S D C+M+W+F+PQLRA R GH A+ Sbjct: 2 DPTLERSFRGHKDAVTSVCFNHNMKQLVSGSLDNCVMVWNFKPQLRAFRFAGHKAS 57
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A3F2RKG0_9STRA (Uncharacterized protein n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2RKG0_9STRA) HSP 1 Score: 72.4 bits (176), Expect = 2.890e-12 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLVGHTAAV 318 +P LERTFRGH+ VT V+F +A+Q+ SSS DG +M+W+F+PQLRA R GH V Sbjct: 3 NPSLERTFRGHKSAVTGVNFHPNAQQVASSSLDGVVMVWNFKPQLRAFRFKGHAGPV 59
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A5J4XNY1_9CHLO (POC1 centriolar protein A (Fragment) n=1 Tax=Trebouxia sp. A1-2 TaxID=2608996 RepID=A0A5J4XNY1_9CHLO) HSP 1 Score: 78.6 bits (192), Expect = 8.780e-12 Identity = 32/52 (61.54%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 139 EQRDPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATR 294 + DP LER+FRGH+D VT+V+F+H+ KQL+S S DGC+M+W+F+PQLRA R Sbjct: 10 QPEDPTLERSFRGHKDAVTSVAFNHNMKQLISGSLDGCVMVWNFKPQLRAFR 61
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A7S1AMN1_NOCSC (Hypothetical protein (Fragment) n=1 Tax=Noctiluca scintillans TaxID=2966 RepID=A0A7S1AMN1_NOCSC) HSP 1 Score: 74.3 bits (181), Expect = 1.500e-11 Identity = 32/51 (62.75%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLV 300 DP LER FRGHR VT V F H+ +Q+VSSS DGC+ +WHFRPQ+R R V Sbjct: 11 DPSLERAFRGHRGAVTGVVFLHEEQQVVSSSLDGCVFVWHFRPQMRPYRFV 61
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A6A0A6V2_HAELA (WD_REPEATS_REGION domain-containing protein n=1 Tax=Haematococcus lacustris TaxID=44745 RepID=A0A6A0A6V2_HAELA) HSP 1 Score: 75.1 bits (183), Expect = 2.870e-11 Identity = 31/49 (63.27%), Postives = 42/49 (85.71%), Query Frame = 1 Query: 148 DPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATR 294 DP LER+FRGH+D VT+V F+++ KQL+S S DGC+M+W+F+PQLRA R Sbjct: 5 DPTLERSFRGHKDAVTSVCFNNNMKQLISGSLDGCVMIWNFKPQLRAYR 53
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A2J8A9K8_9CHLO (POC1 centriolar A n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8A9K8_9CHLO) HSP 1 Score: 77.0 bits (188), Expect = 3.000e-11 Identity = 35/64 (54.69%), Postives = 47/64 (73.44%), Query Frame = 1 Query: 106 SKAAQIALPPPEQ-RDPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATR 294 +K+ LP Q DP LER+FRGH+D VT+V F+H+ KQ+VS S D C+M+W+F+PQLRA R Sbjct: 3 AKSGMAPLPTESQVEDPTLERSFRGHKDAVTSVCFNHNMKQMVSGSLDNCVMVWNFKPQLRAFR 66
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A8J4FDZ9_9CHLO (Uncharacterized protein n=5 Tax=Volvox TaxID=3066 RepID=A0A8J4FDZ9_9CHLO) HSP 1 Score: 77.0 bits (188), Expect = 3.000e-11 Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 1 Query: 103 GSKAAQIALPPPEQ-RDPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATR 294 G++ LP Q DP LER+FRGH+D VT+V F+H+ KQLVS S D C+M+W+F+PQLRA R Sbjct: 5 GARHGLAPLPAESQVEDPTLERSFRGHKDAVTSVCFNHNMKQLVSGSLDNCVMVWNFKPQLRAFR 69
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Match: A0A5F8H718_MONDO (Uncharacterized protein n=9 Tax=Metatheria TaxID=9263 RepID=A0A5F8H718_MONDO) HSP 1 Score: 76.3 bits (186), Expect = 3.340e-11 Identity = 33/56 (58.93%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 133 PPEQRDPELERTFRGHRDVVTAVSFSHDAKQLVSSSQDGCLMLWHFRPQLRATRLV 300 P + DP LER FRGH+D VT+V FS + KQLVS S D CLM+WH +P +RA R V Sbjct: 12 PGRKEDPSLERNFRGHKDAVTSVDFSANRKQLVSGSMDACLMIWHMKPHMRAYRFV 67 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig116.2.2 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig116.2.2 >prot_P-wetherbeei_contig116.2.2 ID=prot_P-wetherbeei_contig116.2.2|Name=mRNA_P-wetherbeei_contig116.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=502bp MLSADARGARARIGRPTGSKAAQIALPPPEQRDPELERTFRGHRDVVTAVback to top mRNA from alignment at P-wetherbeei_contig116:4236..7041+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig116.2.2 ID=mRNA_P-wetherbeei_contig116.2.2|Name=mRNA_P-wetherbeei_contig116.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=2806bp|location=Sequence derived from alignment at P-wetherbeei_contig116:4236..7041+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig116:4236..7041+ >mRNA_P-wetherbeei_contig116.2.2 ID=mRNA_P-wetherbeei_contig116.2.2|Name=mRNA_P-wetherbeei_contig116.2.2|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=1506bp|location=Sequence derived from alignment at P-wetherbeei_contig116:4236..7041+ (Phaeothamnion wetherbeei SAG_119_79)back to top |