mRNA_P-wetherbeei_contig1048.6.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1048.6.1 vs. uniprot
Match: A0A835YPK8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YPK8_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 2.320e-7 Identity = 26/49 (53.06%), Postives = 34/49 (69.39%), Query Frame = 3 Query: 672 MSLLDEVLAMALGRLPREPGISEAEHFRTVAEFHCRVREQWLRELGMLP 818 + L+D V AM LGR+PR P S+AEH + VA H R+R+ WL+E G LP Sbjct: 110 LPLIDRVAAMILGRMPRNPRASDAEHLQYVAVCHARIRDAWLQEFGRLP 158 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1048.6.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1048.6.1 >prot_P-wetherbeei_contig1048.6.1 ID=prot_P-wetherbeei_contig1048.6.1|Name=mRNA_P-wetherbeei_contig1048.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=260bp MEGEDEEATEGGGGGNGGSGDAVISRALNGGVVANSCARANGAGVREGAAback to top mRNA from alignment at P-wetherbeei_contig1048:6440..7427+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1048.6.1 ID=mRNA_P-wetherbeei_contig1048.6.1|Name=mRNA_P-wetherbeei_contig1048.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=988bp|location=Sequence derived from alignment at P-wetherbeei_contig1048:6440..7427+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1048:6440..7427+ >mRNA_P-wetherbeei_contig1048.6.1 ID=mRNA_P-wetherbeei_contig1048.6.1|Name=mRNA_P-wetherbeei_contig1048.6.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=780bp|location=Sequence derived from alignment at P-wetherbeei_contig1048:6440..7427+ (Phaeothamnion wetherbeei SAG_119_79)back to top |