mRNA_P-wetherbeei_contig10368.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10368.2.1 vs. uniprot
Match: K3WTV5_GLOUD (BRCT domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WTV5_GLOUD) HSP 1 Score: 52.4 bits (124), Expect = 2.680e-6 Identity = 20/59 (33.90%), Postives = 35/59 (59.32%), Query Frame = 1 Query: 13 KVIVVATPLSYRKYKYVYGVAAGHRIVHHKWVERSILQSTFLQTPPFLLPGGVAFFRRK 189 K +V+ATP+S+RK K++Y +A G +VH +W+ + + + +P G +F RK Sbjct: 89 KAVVIATPVSWRKLKFIYAIACGIPVVHPEWIHACVTAGKVVSFDGYFIPSGYSFTTRK 147 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10368.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10368.2.1 >prot_P-wetherbeei_contig10368.2.1 ID=prot_P-wetherbeei_contig10368.2.1|Name=mRNA_P-wetherbeei_contig10368.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=63bp PASQKVIVVATPLSYRKYKYVYGVAAGHRIVHHKWVERSILQSTFLQTPPback to top mRNA from alignment at P-wetherbeei_contig10368:1571..1759+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10368.2.1 ID=mRNA_P-wetherbeei_contig10368.2.1|Name=mRNA_P-wetherbeei_contig10368.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig10368:1571..1759+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10368:1571..1759+ >mRNA_P-wetherbeei_contig10368.2.1 ID=mRNA_P-wetherbeei_contig10368.2.1|Name=mRNA_P-wetherbeei_contig10368.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=189bp|location=Sequence derived from alignment at P-wetherbeei_contig10368:1571..1759+ (Phaeothamnion wetherbeei SAG_119_79)back to top |