mRNA_P-wetherbeei_contig10346.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A835Z5R8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z5R8_9STRA) HSP 1 Score: 84.0 bits (206), Expect = 2.370e-16 Identity = 40/69 (57.97%), Postives = 47/69 (68.12%), Query Frame = 3 Query: 333 LMLLFGTVFIATGARLWFHEGTER--AYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDDD 533 LML+ G+ GA LW + ER AY L++IG IL LPGSYAS NL GAY+GW G+ Y IPSYDDD Sbjct: 74 LMLVGGSALSLAGAALWLLQPAERERAYALLLIGGILFLPGSYASVNLFGAYMGWPGYSYDAIPSYDDD 142
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: W7U4P6_9STRA (Uncharacterized protein n=3 Tax=Monodopsidaceae TaxID=425072 RepID=W7U4P6_9STRA) HSP 1 Score: 77.4 bits (189), Expect = 5.140e-14 Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 3 Query: 276 PRYVPERPPSPPKTTIAATLMLLFGTVFIATGARLWFH---EGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 PR P R P +AA LML+ GT+ + TG + +H + ER ++++G++L +PGSYAS+ L GA+ GW G+ Y IPSYDD Sbjct: 46 PRRRPGRGPXXXXXXLAAVLMLVTGTILLCTGLGIRWHTDPKEKERGLAMIILGSLLFIPGSYASFQLFGAWAGWPGYSYAYIPSYDD 133
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A5D6XII8_9STRA (Transmembrane protein 230 n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XII8_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 3.280e-12 Identity = 33/75 (44.00%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 P +T +AA + G+V I R+ +G R +++G I +PGSYASY L G+Y GW G+DY IPSYDD Sbjct: 43 PVRTGMAAASLFALGSVLIFVSTRIGL-DGEHRGLSFLILGLIAFIPGSYASYQLYGSYKGWKGYDYSQIPSYDD 116
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A7S3H8Q2_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H8Q2_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 5.680e-12 Identity = 33/80 (41.25%), Postives = 49/80 (61.25%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATG-----ARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 PPKTTI A L G F+A G A +W H G +R ++++G ++ +PGSYA ++G + GW G+DY +PSYD+ Sbjct: 47 PPKTTIVAFLFFFGGLFFLAFGLSVLLAHIWKH-GQDRGIAMIVLGGLMFIPGSYAVTIIVGTWYGWRGYDYSQLPSYDE 125
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: K3X3J5_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X3J5_GLOUD) HSP 1 Score: 71.6 bits (174), Expect = 5.820e-12 Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 P +T +AA + G++ I R+ +G R +++G I +PGSYASY L G+Y GW G+DY IPSYDD Sbjct: 53 PIRTGLAAVSLFTLGSIMIFASTRIGL-DGEHRGLSFLILGLIAFIPGSYASYQLYGSYKGWKGYDYSQIPSYDD 126
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A8K1FTP9_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1FTP9_PYTOL) HSP 1 Score: 67.4 bits (163), Expect = 1.830e-10 Identity = 31/75 (41.33%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 P +T IAA ++ G+V I R+ +G +R ++G I +PGSYA+ L G++ GW G+DY IPSYDD Sbjct: 48 PIRTGIAAIVLFTLGSVLIWVSTRIGL-DGEQRGLSFFILGLIAFIPGSYATVQLYGSFKGWKGYDYSQIPSYDD 121
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A1V9YR85_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YR85_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 7.950e-10 Identity = 30/75 (40.00%), Postives = 44/75 (58.67%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 P +T +AA ++ G+V + L+ +G R ++G I +PGSYA+ L GAY GW G+DY +PSYDD Sbjct: 42 PIRTGLAAVVLFTIGSVLLYVST-LFGLDGERRGLSFFVLGLITFIPGSYATTQLYGAYKGWPGYDYSQLPSYDD 115
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A6G0WPK7_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WPK7_9STRA) HSP 1 Score: 65.1 bits (157), Expect = 9.710e-10 Identity = 29/75 (38.67%), Postives = 42/75 (56.00%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 P +T +AA + G+V + R + +R ++G I +PGSYA+ L GAY GW G+DY +PSYDD Sbjct: 37 PIRTAMAAVTLFTLGSVLLYVSTRFGLDD-EQRGLSFFILGLITFIPGSYATTQLYGAYKGWPGYDYSQVPSYDD 110
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A6S8XXG7_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A6S8XXG7_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.340e-9 Identity = 33/82 (40.24%), Postives = 48/82 (58.54%), Query Frame = 3 Query: 306 PPKTTIAATLMLLFGTVFIATGA-RLWFHEGTERAYG---LMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDDD*L 539 PP+T +AA + G V I TG W+ G + Y L ++G I +PGSYA++NL GA+ + GF+Y +PS+DD L Sbjct: 28 PPRTALAALFLTTVGLVVIITGIYEKWYDVGPDVPYHYFTLFLLGFITFVPGSYATFNLWGAFRRYPGFEYDQVPSWDDQAL 109
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Match: A0A5A8CLB8_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8CLB8_CAFRO) HSP 1 Score: 63.5 bits (153), Expect = 2.040e-9 Identity = 29/72 (40.28%), Postives = 46/72 (63.89%), Query Frame = 3 Query: 315 TTIAATLMLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLGWDGFDYRDIPSYDD 530 TT+ A +L+ GTV + G +GT+R+ ++++G++ +PGSYAS+ LLGA W + Y +PSYDD Sbjct: 18 TTLMAVFLLVAGTVLLGIGIP-ELAQGTDRSISMVVLGSLCFIPGSYASWILLGACQRWRNYRYDQLPSYDD 88 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10346.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10346.2.1 >prot_P-wetherbeei_contig10346.2.1 ID=prot_P-wetherbeei_contig10346.2.1|Name=mRNA_P-wetherbeei_contig10346.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=67bp MLLFGTVFIATGARLWFHEGTERAYGLMMIGAILLLPGSYASYNLLGAYLback to top mRNA from alignment at P-wetherbeei_contig10346:1032..2364+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10346.2.1 ID=mRNA_P-wetherbeei_contig10346.2.1|Name=mRNA_P-wetherbeei_contig10346.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1333bp|location=Sequence derived from alignment at P-wetherbeei_contig10346:1032..2364+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10346:1032..2364+ >mRNA_P-wetherbeei_contig10346.2.1 ID=mRNA_P-wetherbeei_contig10346.2.1|Name=mRNA_P-wetherbeei_contig10346.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=201bp|location=Sequence derived from alignment at P-wetherbeei_contig10346:1032..2364+ (Phaeothamnion wetherbeei SAG_119_79)back to top |