mRNA_P-wetherbeei_contig10251.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Match: A0A3R7G0W5_9STRA (Dihydrolipoyllysine-residue succinyltransferase n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7G0W5_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 5.470e-5 Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 2 Query: 2 KHGVKLGFMSAFVKASCEALIELPAVNGCEPDGNRSQSWISFFD-SVPSST 151 KHGVKLGFMSAFVKAS AL+E+P VN D ++ + F D SV ST Sbjct: 328 KHGVKLGFMSAFVKASASALLEVPGVNAMIDDEHQEIVYRDFVDMSVAVST 378
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Match: A0A261Y551_9FUNG (Dihydrolipoyllysine-residue succinyltransferase n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y551_9FUNG) HSP 1 Score: 52.4 bits (124), Expect = 5.480e-5 Identity = 24/28 (85.71%), Postives = 25/28 (89.29%), Query Frame = 2 Query: 2 KHGVKLGFMSAFVKASCEALIELPAVNG 85 KHG+KLGFMSAF KASC AL ELPAVNG Sbjct: 331 KHGIKLGFMSAFAKASCVALQELPAVNG 358
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Match: A0A662Y5U8_9STRA (Dihydrolipoyllysine-residue succinyltransferase n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662Y5U8_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 5.550e-5 Identity = 29/51 (56.86%), Postives = 34/51 (66.67%), Query Frame = 2 Query: 2 KHGVKLGFMSAFVKASCEALIELPAVNGCEPDGNRSQSWISFFD-SVPSST 151 KHGVKLGFMSAFVKAS AL+E+P VN D ++ + F D SV ST Sbjct: 365 KHGVKLGFMSAFVKASASALLEVPGVNAMIDDEHQEIVYRDFVDMSVAVST 415
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Match: A0A835Z206_9STRA (Dihydrolipoyllysine-residue succinyltransferase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z206_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 9.290e-5 Identity = 24/28 (85.71%), Postives = 26/28 (92.86%), Query Frame = 2 Query: 2 KHGVKLGFMSAFVKASCEALIELPAVNG 85 KHGVKLGFMSAFVKAS +AL E+PAVNG Sbjct: 189 KHGVKLGFMSAFVKASADALREIPAVNG 216
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Match: L8GT97_ACACA (Dihydrolipoyllysine-residue succinyltransferase n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GT97_ACACA) HSP 1 Score: 51.6 bits (122), Expect = 9.310e-5 Identity = 26/44 (59.09%), Postives = 29/44 (65.91%), Query Frame = 2 Query: 2 KHGVKLGFMSAFVKASCEALIELPAVNGCEPDGNRSQSWISFFD 133 KHGVKLGFMSAFVKAS AL E+PAVN NR + + D Sbjct: 191 KHGVKLGFMSAFVKASAAALKEIPAVNAVYDGSNREIIYRDYVD 234 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10251.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10251.1.1 >prot_P-wetherbeei_contig10251.1.1 ID=prot_P-wetherbeei_contig10251.1.1|Name=mRNA_P-wetherbeei_contig10251.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=102bp MASSLASCPPSSRRLARPSSSCPPSMGVSRMGIEVRAGSRFLIACLPPQSback to top mRNA from alignment at P-wetherbeei_contig10251:626..1090+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10251.1.1 ID=mRNA_P-wetherbeei_contig10251.1.1|Name=mRNA_P-wetherbeei_contig10251.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=465bp|location=Sequence derived from alignment at P-wetherbeei_contig10251:626..1090+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10251:626..1090+ >mRNA_P-wetherbeei_contig10251.1.1 ID=mRNA_P-wetherbeei_contig10251.1.1|Name=mRNA_P-wetherbeei_contig10251.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=306bp|location=Sequence derived from alignment at P-wetherbeei_contig10251:626..1090+ (Phaeothamnion wetherbeei SAG_119_79)back to top |