mRNA_P-wetherbeei_contig1024.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A7S1CLD0_9STRA (Hypothetical protein n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CLD0_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 6.890e-12 Identity = 36/58 (62.07%), Postives = 46/58 (79.31%), Query Frame = 3 Query: 72 VVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQ--AATQAADPEEELE 239 + EVLPK+GLVYSEK L+E+LCKPK++PIKSL EKLE++ Q AAT+AA + E E Sbjct: 5 IAEVLPKAGLVYSEKGNLSEILCKPKIMPIKSLTLEKLEQMEQEAAATEAARGDMEAE 62
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A835Z1E9_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z1E9_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.370e-10 Identity = 33/52 (63.46%), Postives = 40/52 (76.92%), Query Frame = 3 Query: 78 EVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAATQAADPEEE 233 EV+ K GLV+SEK +L EVLCKPKLLPIKS+A EKLE L AA + +P+ E Sbjct: 8 EVIAKKGLVFSEKPSLHEVLCKPKLLPIKSVALEKLEALEAAANRPPEPQSE 59
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A7S2GMJ4_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2GMJ4_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 2.400e-10 Identity = 37/68 (54.41%), Postives = 48/68 (70.59%), Query Frame = 3 Query: 60 SATG---VVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAATQAADPEEELEKPEGR 254 S TG + EVLPK+GLVYSEK +L+E+LCKPK+LPIKS+A + LE +Q A A+ EE EG+ Sbjct: 49 SGTGRLQISEVLPKNGLVYSEKGSLSEILCKPKILPIKSVALQTLEDKLQEAQLDAEIEEAKVTEEGK 116
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A0M0LPT4_9EUKA (Bbsome-interacting protein 1-like protein n=2 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0LPT4_9EUKA) HSP 1 Score: 59.7 bits (143), Expect = 5.960e-10 Identity = 29/45 (64.44%), Postives = 39/45 (86.67%), Query Frame = 3 Query: 72 VVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAA 206 ++EVLPK+GLVYSEK L+EVLCKPK++PIKS++ E+LE + Q A Sbjct: 11 LLEVLPKAGLVYSEKGNLSEVLCKPKIMPIKSVSLERLEAMEQQA 55
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A6H5KLR6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KLR6_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 6.410e-10 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 63 ATGVVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLE 188 A + E+LPK+GLVYSEK+ L+EVLCKPKL+PIKS+ +KLE Sbjct: 14 AASLAELLPKNGLVYSEKTTLSEVLCKPKLMPIKSITLQKLE 55
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: R1EVH0_EMIHU (Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1EVH0_EMIHU) HSP 1 Score: 59.7 bits (143), Expect = 9.710e-10 Identity = 30/46 (65.22%), Postives = 38/46 (82.61%), Query Frame = 3 Query: 78 EVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAATQA 215 EVLPK+GLV+SEK +L VLCKPKL+PIKSL+ EK+E++ AA A Sbjct: 10 EVLPKAGLVFSEKGSLAPVLCKPKLMPIKSLSLEKIEQMESAAAAA 55
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A7S2R5F7_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2R5F7_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 9.820e-10 Identity = 31/52 (59.62%), Postives = 41/52 (78.85%), Query Frame = 3 Query: 78 EVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAATQAADPEEE 233 E+LPKSGLVYSEK +L+EVLCKPK++PIKSL+ ++ E+ QA A+ E E Sbjct: 43 ELLPKSGLVYSEKGSLSEVLCKPKIMPIKSLSIQRQEERRQALADQAESERE 94
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: J9HZC4_9SPIT (Uncharacterized protein n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9HZC4_9SPIT) HSP 1 Score: 58.9 bits (141), Expect = 1.090e-9 Identity = 25/41 (60.98%), Postives = 38/41 (92.68%), Query Frame = 3 Query: 72 VVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKL 194 + E++PK+GLVYSEK+AL+E+LCKPK+LP+KS+ +KLE++ Sbjct: 15 IKEIMPKAGLVYSEKAALSEILCKPKILPLKSVTLQKLEQM 55
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A2J8AHG4_9CHLO (BBSome-interacting protein 1 n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AHG4_9CHLO) HSP 1 Score: 58.9 bits (141), Expect = 1.290e-9 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 69 GVVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKL 194 GV EVLPK+GLV SEK LTE+LCKPKL+P+KS+ +KLE++ Sbjct: 8 GVKEVLPKAGLVVSEKGNLTEILCKPKLMPLKSITLQKLEEM 49
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Match: A0A5A8DAU6_CAFRO (Uncharacterized protein n=1 Tax=Cafeteria roenbergensis TaxID=33653 RepID=A0A5A8DAU6_CAFRO) HSP 1 Score: 60.1 bits (144), Expect = 1.650e-9 Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = 3 Query: 72 VVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAATQAADPEEELEKP 245 + E+LP GLVYSE+ L+EV+CKPK+LPIKS+ E+LE+L + A +AA + KP Sbjct: 20 IAELLPLDGLVYSERQELSEVMCKPKILPIKSVTMERLEQLEEDAAKAAREARTVSKP 77 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1024.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1024.1.1 >prot_P-wetherbeei_contig1024.1.1 ID=prot_P-wetherbeei_contig1024.1.1|Name=mRNA_P-wetherbeei_contig1024.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=75bp MSATGVVEVLPKSGLVYSEKSALTEVLCKPKLLPIKSLAQEKLEKLVQAAback to top mRNA from alignment at P-wetherbeei_contig1024:1643..1923- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1024.1.1 ID=mRNA_P-wetherbeei_contig1024.1.1|Name=mRNA_P-wetherbeei_contig1024.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=281bp|location=Sequence derived from alignment at P-wetherbeei_contig1024:1643..1923- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1024:1643..1923- >mRNA_P-wetherbeei_contig1024.1.1 ID=mRNA_P-wetherbeei_contig1024.1.1|Name=mRNA_P-wetherbeei_contig1024.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=225bp|location=Sequence derived from alignment at P-wetherbeei_contig1024:1643..1923- (Phaeothamnion wetherbeei SAG_119_79)back to top |