mRNA_P-wetherbeei_contig10234.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: A0A836C876_9STRA (Scd6-like Sm domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C876_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 2.450e-9 Identity = 30/40 (75.00%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 1 KYKKSSFFDEISCDALDGRERGGGYRERNLNAETFGATSL 120 KY KSSFFDEISCDALDGR R G+ ER LN ETFGAT + Sbjct: 237 KYNKSSFFDEISCDALDGRHRVPGFTERKLNTETFGATGV 276
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: A0A6H5KDD7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDD7_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 2.000e-6 Identity = 30/43 (69.77%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 KYKKSSFFDEISCDALDGRER--GGGYRERNLNAETFGATSLV 123 KY KSSFFDEISCDALDGR GG ER N ETFGATS+ Sbjct: 339 KYNKSSFFDEISCDALDGRGHMPGGRGGERMRNTETFGATSVA 381
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: K3WC16_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WC16_GLOUD) HSP 1 Score: 53.1 bits (126), Expect = 1.580e-5 Identity = 31/52 (59.62%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDGRE----RGGGYRERNLNAETFGATSLVYEDSGGGG 147 Y+KSSFFD ISCDALD E R GY ER LN ETFGA L S GG Sbjct: 235 YQKSSFFDTISCDALDRLEGNKGRMSGYEERKLNTETFGAVGLNNRRSFRGG 286
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: D7FK17_ECTSI (Novel Sm-like protein with long N-and C-terminal domains n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK17_ECTSI) HSP 1 Score: 52.8 bits (125), Expect = 2.150e-5 Identity = 28/41 (68.29%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 7 KKSSFFDEISCDALDGRER--GGGYRERNLNAETFGATSLV 123 +KSSFFDEISCDALDGR GG ER N ETFGATS+ Sbjct: 222 EKSSFFDEISCDALDGRGHMPGGRGGERTRNTETFGATSVA 262
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: W4GVK0_9STRA (Uncharacterized protein n=8 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GVK0_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 2.360e-5 Identity = 29/44 (65.91%), Postives = 30/44 (68.18%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDGRERGGGYR-----ERNLNAETFGATSL 120 Y+KSSFFD ISCDALD E GG R ER LN ETFGA SL Sbjct: 315 YQKSSFFDTISCDALDRLEGNGGGRMRAQEERKLNTETFGAVSL 358
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: A0A3F2RWG2_9STRA (Uncharacterized protein n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2RWG2_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 3.890e-5 Identity = 33/60 (55.00%), Postives = 35/60 (58.33%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDG----RERGGGYRERNLNAETFGATSLVYEDS--GGGGNHGRYN 165 Y+KSSFFD ISCDALD R R G ER LN ETFGA L + GG G GR N Sbjct: 212 YQKSSFFDTISCDALDRLEGQRARMSGAEERKLNTETFGAVGLNNRRNFRGGRGRGGRRN 271
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: A0A3R7GHF0_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7GHF0_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 4.140e-5 Identity = 33/60 (55.00%), Postives = 35/60 (58.33%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDG----RERGGGYRERNLNAETFGATSLVYEDS--GGGGNHGRYN 165 Y+KSSFFD ISCDALD R R G ER LN ETFGA L + GG G GR N Sbjct: 260 YQKSSFFDTISCDALDRLEGQRARMSGAEERKLNTETFGAVGLNNRRNFRGGRGRGGRRN 319
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: A0A1V9Y4S2_9STRA (Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9Y4S2_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 5.790e-5 Identity = 30/55 (54.55%), Postives = 33/55 (60.00%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDGRERGGG----YRERNLNAETFGATSLVYEDSGGGGNHG 156 Y+KSSFFD ISCDALD E G + ER LN ETFGA L + GGN G Sbjct: 257 YQKSSFFDTISCDALDRLEGVNGRMRAHEERKLNTETFGAVGLNNRRNYRGGNRG 311
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Match: D0NAR7_PHYIT (Uncharacterized protein n=3 Tax=Phytophthora TaxID=4783 RepID=D0NAR7_PHYIT) HSP 1 Score: 50.1 bits (118), Expect = 5.860e-5 Identity = 27/43 (62.79%), Postives = 28/43 (65.12%), Query Frame = 1 Query: 4 YKKSSFFDEISCDALDG----RERGGGYRERNLNAETFGATSL 120 Y+KSSFFD ISCDALD R R G ER LN ETFGA L Sbjct: 61 YQKSSFFDTISCDALDRLEGQRSRMSGAEERKLNTETFGAVGL 103 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10234.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 9
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10234.1.1 >prot_P-wetherbeei_contig10234.1.1 ID=prot_P-wetherbeei_contig10234.1.1|Name=mRNA_P-wetherbeei_contig10234.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=135bp KYKKSSFFDEISCDALDGRERGGGYRERNLNAETFGATSLVYEDSGGGGNback to top mRNA from alignment at P-wetherbeei_contig10234:1593..1997- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10234.1.1 ID=mRNA_P-wetherbeei_contig10234.1.1|Name=mRNA_P-wetherbeei_contig10234.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=405bp|location=Sequence derived from alignment at P-wetherbeei_contig10234:1593..1997- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10234:1593..1997- >mRNA_P-wetherbeei_contig10234.1.1 ID=mRNA_P-wetherbeei_contig10234.1.1|Name=mRNA_P-wetherbeei_contig10234.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=405bp|location=Sequence derived from alignment at P-wetherbeei_contig10234:1593..1997- (Phaeothamnion wetherbeei SAG_119_79)back to top |