mRNA_P-wetherbeei_contig10228.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10228.2.1 vs. uniprot
Match: D8LC61_ECTSI (Putative copper transporter n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LC61_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 3.040e-12 Identity = 45/93 (48.39%), Postives = 58/93 (62.37%), Query Frame = 2 Query: 416 QVSPKMEVRPQTLVRCLDEIGFMSAFISSSTT-EMLGPGDDSSAVWAIAAALGLVDRGCAMAWGGECSCDPSNCRCVNCTIHVSEAASAVNEV 691 +V K V L LD IGF S+ ++++TT E D +AVWAIA ALGLVD GCAMAWG CSC +CRC+NC H+ + + AV+ V Sbjct: 721 KVDAKANVTLGDLTSALDAIGFGSSCVATTTTQEPTLEQDGVNAVWAIANALGLVDPGCAMAWGRPCSCG-DDCRCINCPQHMKKVSHAVDLV 812 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10228.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10228.2.1 >prot_P-wetherbeei_contig10228.2.1 ID=prot_P-wetherbeei_contig10228.2.1|Name=mRNA_P-wetherbeei_contig10228.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=127bp MEVRPQTLVRCLDEIGFMSAFISSSTTEMLGPGDDSSAVWAIAAALGLVDback to top mRNA from alignment at P-wetherbeei_contig10228:813..1935- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10228.2.1 ID=mRNA_P-wetherbeei_contig10228.2.1|Name=mRNA_P-wetherbeei_contig10228.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1123bp|location=Sequence derived from alignment at P-wetherbeei_contig10228:813..1935- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10228:813..1935- >mRNA_P-wetherbeei_contig10228.2.1 ID=mRNA_P-wetherbeei_contig10228.2.1|Name=mRNA_P-wetherbeei_contig10228.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=381bp|location=Sequence derived from alignment at P-wetherbeei_contig10228:813..1935- (Phaeothamnion wetherbeei SAG_119_79)back to top |