mRNA_P-wetherbeei_contig10068.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: UPI00083C4A4D (general transcription factor 3C polypeptide 5 n=1 Tax=Nicrophorus vespilloides TaxID=110193 RepID=UPI00083C4A4D) HSP 1 Score: 72.8 bits (177), Expect = 3.850e-10 Identity = 32/77 (41.56%), Postives = 47/77 (61.04%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHI---VAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSA 543 ++ +F+ RP+WS+ L+ +T T+ +HI VAY NGPWR WIR+GY P DP A+ Q LD+R+ S+ Sbjct: 255 LKELFEERPIWSRQALLYDT----GFTVEQLKHILPKVAYYYLNGPWRVMWIRFGYNPKKDPNAKIYQTLDIRIRSS 327
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A8J2RZJ6_9CRUS (Hypothetical protein n=1 Tax=Daphnia galeata TaxID=27404 RepID=A0A8J2RZJ6_9CRUS) HSP 1 Score: 72.4 bits (176), Expect = 5.190e-10 Identity = 32/78 (41.03%), Postives = 46/78 (58.97%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSAILNE 555 ++ MF+ RPVW+K+ LI ++++ VAY TNGPWR W+R GY P DP+AR Q LD R++ N+ Sbjct: 275 IKKMFEERPVWTKAALIYNVAGVDKNSLRFILASVAYYFTNGPWRNAWVRIGYDPRKDPEARIYQILDYRISQNYRNK 352
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A5J4N6Y1_9TREM (General transcription factor 3C polypeptide 5 (Transcription factor C subunit 1) (Fragment) n=1 Tax=Paragonimus westermani TaxID=34504 RepID=A0A5J4N6Y1_9TREM) HSP 1 Score: 68.6 bits (166), Expect = 6.460e-9 Identity = 28/77 (36.36%), Postives = 44/77 (57.14%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIV-AYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSAIL 549 ++ +F RPVW ++ L+ + T+ C + AY GPW + W+RYGY P DP+AR+ Q +D R+ S +L Sbjct: 242 LEELFNSRPVWVRNALVHHLGTESRQTIFKCGILAFAYYFVRGPWGRTWVRYGYDPRTDPEARYFQVIDFRIKSHVL 318
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: E9FVE5_DAPPU (Uncharacterized protein n=3 Tax=Daphnia TaxID=6668 RepID=E9FVE5_DAPPU) HSP 1 Score: 68.6 bits (166), Expect = 8.570e-9 Identity = 30/75 (40.00%), Postives = 43/75 (57.33%), Query Frame = 1 Query: 331 MFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSAILNE 555 MF+ RPVW+K+ L + ++++ VAY T GPWR W+R GY P DP+AR Q LD R++ N+ Sbjct: 254 MFEERPVWTKAALTYQVAGVDKNSLRFILASVAYYFTTGPWRNAWVRIGYDPRKDPEARIYQILDFRISQNYRNK 328
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A0L0HHZ6_SPIPD (Uncharacterized protein n=2 Tax=Spizellomyces TaxID=4815 RepID=A0A0L0HHZ6_SPIPD) HSP 1 Score: 67.4 bits (163), Expect = 2.130e-8 Identity = 31/70 (44.29%), Postives = 41/70 (58.57%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVR 531 M+ +FQ RP+W++ L ++ M I AY AT+GPWR WIRYGY P D +AR Q +DVR Sbjct: 259 MRALFQERPIWTRLALHNSMPPAYRNLMKRLMPIHAYVATSGPWRDCWIRYGYDPRRDREARLYQIIDVR 328
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A397SYC3_9GLOM (RNA polymerase III transcription factor IIIC subunit-domain-containing protein n=1 Tax=Glomus cerebriforme TaxID=658196 RepID=A0A397SYC3_9GLOM) HSP 1 Score: 66.6 bits (161), Expect = 3.590e-8 Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVT 537 M +F+ RP+W++ L + + +VAY +NGPWR WIRYGY P + +ARF Q LD+R T Sbjct: 240 MNKLFEDRPIWTRLALENNLPSNDKRNIKRLLPLVAYLMSNGPWRDCWIRYGYDPRLNQEARFYQLLDIRNT 311
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A162T0L4_9CRUS (Lethal (2) 37Cd n=2 Tax=Daphnia magna TaxID=35525 RepID=A0A162T0L4_9CRUS) HSP 1 Score: 66.2 bits (160), Expect = 5.170e-8 Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSAILNE 555 ++ MF+ RPVW+K+ L ++++ AY T GPWR W+R GY P DP+AR Q LD R++ N+ Sbjct: 307 IRKMFEERPVWTKAALTYHVAGVDKNSLRFILASAAYYFTTGPWRNAWVRIGYDPRQDPEARIHQILDFRISQNFRNK 384
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A482V8K9_9CUCU (General transcription factor 3C polypeptide 5 n=1 Tax=Asbolus verrucosus TaxID=1661398 RepID=A0A482V8K9_9CUCU) HSP 1 Score: 65.9 bits (159), Expect = 7.410e-8 Identity = 28/71 (39.44%), Postives = 43/71 (60.56%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRV 534 ++ +F+ RP+W+K+ + T +H+ +VAY NGPWR W+++GY P DPQAR Q LD R+ Sbjct: 319 VKQLFEERPIWTKAAIRYNTGLTDEHSKVILP-VVAYYFINGPWRISWVKFGYDPRRDPQARIYQTLDYRI 388
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A482WL55_LAOST (Uncharacterized protein n=1 Tax=Laodelphax striatellus TaxID=195883 RepID=A0A482WL55_LAOST) HSP 1 Score: 65.1 bits (157), Expect = 1.080e-7 Identity = 33/95 (34.74%), Postives = 54/95 (56.84%), Query Frame = 1 Query: 289 PLLRRYMCVRFM--------QHMFQRRPVWSKSELIRETREWGQHTMNDCEHI---VAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTS 540 P +Y+ ++F+ + F+RRP+WSK+ LI ET+ ++++ +++ VAY GP+R W+R GY P DP +R Q LD R+ S Sbjct: 220 PSALKYLELKFLAMDHYEKIKQCFERRPIWSKTALIYETK----YSIDKIKYLLPSVAYHFVTGPFRVMWVRIGYDPRKDPSSRIYQTLDYRIPS 310
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Match: A0A5E4QXI0_9NEOP (Uncharacterized protein n=1 Tax=Leptidea sinapis TaxID=189913 RepID=A0A5E4QXI0_9NEOP) HSP 1 Score: 64.3 bits (155), Expect = 1.800e-7 Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 1 Query: 322 MQHMFQRRPVWSKSELIRETREWGQHTMNDCEHIVAYKATNGPWRQFWIRYGYTPHADPQARFLQALDVRVTSAILN 552 ++ MF+ RP+WS S L++ + ++ +AY GPWR W+RYGY P +P AR Q LD R+ +L+ Sbjct: 248 VKKMFEDRPIWSSS-LVKHLTNIKEPSLRMIFPCLAYYLKTGPWRLLWVRYGYDPRKEPNARIYQTLDFRLRHTVLS 323 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10068.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10068.1.1 >prot_P-wetherbeei_contig10068.1.1 ID=prot_P-wetherbeei_contig10068.1.1|Name=mRNA_P-wetherbeei_contig10068.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=428bp MTTGSFGAPAPTAPKAVQKILADMAKANIPRIGGVGVGGGSSDDGGEEGDback to top mRNA from alignment at P-wetherbeei_contig10068:431..2188+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10068.1.1 ID=mRNA_P-wetherbeei_contig10068.1.1|Name=mRNA_P-wetherbeei_contig10068.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1758bp|location=Sequence derived from alignment at P-wetherbeei_contig10068:431..2188+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10068:431..2188+ >mRNA_P-wetherbeei_contig10068.1.1 ID=mRNA_P-wetherbeei_contig10068.1.1|Name=mRNA_P-wetherbeei_contig10068.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=1284bp|location=Sequence derived from alignment at P-wetherbeei_contig10068:431..2188+ (Phaeothamnion wetherbeei SAG_119_79)back to top |