Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99010.24019.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
| Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| None | No IPR available | COILS | Coil | Coil | coord: 154..173 |
| None | No IPR available | PFAM | PF13646 | HEAT_2 | coord: 18..95 e-value: 2.1E-9 score: 37.7 coord: 101..147 e-value: 1.8E-6 score: 28.3 |
| IPR011989 | Armadillo-like helical | GENE3D | 1.25.10.10 | | coord: 10..171 e-value: 4.8E-16 score: 60.7 |
| IPR016024 | Armadillo-type fold | SUPERFAMILY | 48371 | ARM repeat | coord: 16..162 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig99010.24019.1 ID=prot_P-canaliculata_contig99010.24019.1|Name=mRNA_P-canaliculata_contig99010.24019.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=174bp ALEFLKVRWPRDRHPTLIKLVINCVSSDQKFNREAALKILADRDPDQSFP YIFARVDDTSFTIRSLAYQMLRKVGDRRAIKPLAKRFASDDVDRISSLLR SFGSDSEDAVAKYLSDEDPDIRLKACNLIGKIGTVKSLPALEAMQRRETT MMLLAQTRSSINKIERRNQSQSQ* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|