prot_P-canaliculata_contig9965.24079.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig9965.24079.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
KVNIFLTYTGDRYLELEDVDNVHLKLHPLVYTNKKWTPRKLMLRIRRDACLDVLSQVSRNFSNLGSFLNTRL10203040506070Expect = 1.83e-33 / Id = 83.33Expect = 3.43e-33 / Id = 81.94Expect = 7.06e-18 / Id = 48.61Expect = 1.10e-11 / Id = 49.33Expect = 1.49e-11 / Id = 50.00Expect = 1.70e-11 / Id = 59.65Expect = 2.01e-11 / Id = 59.65Expect = 2.05e-11 / Id = 59.65Expect = 2.80e-11 / Id = 59.65Expect = 7.14e-11 / Id = 46.67SequenceD7G7J9_ECTSIA0A6H5KUC4_9PHAEI2CQJ8_NANGCA0A485LBR3_9STRAA0A3L6VCD5_9STRAA0A3R6W6P9_9STRAA0A3L6VUH8_9STRAA0A3R7Y0C2_9STRAA0A024TSZ0_9STRAA0A6G0XTM8_9STRA
Match NameE-valueIdentityDescription
D7G7J9_ECTSI1.830e-3383.33Apt1 domain-containing protein n=1 Tax=Ectocarpus ... [more]
A0A6H5KUC4_9PHAE3.430e-3381.94Apt1 domain-containing protein n=1 Tax=Ectocarpus ... [more]
I2CQJ8_NANGC7.060e-1848.61Apt1 domain-containing protein (Fragment) n=1 Tax=... [more]
A0A485LBR3_9STRA1.100e-1149.33Aste57867_19007 protein n=1 Tax=Aphanomyces stella... [more]
A0A3L6VCD5_9STRA1.490e-1150.00Uncharacterized protein (Fragment) n=1 Tax=Aphanom... [more]
A0A3R6W6P9_9STRA1.700e-1159.65Uncharacterized protein (Fragment) n=2 Tax=Aphanom... [more]
A0A3L6VUH8_9STRA2.010e-1159.65Uncharacterized protein (Fragment) n=1 Tax=Aphanom... [more]
A0A3R7Y0C2_9STRA2.050e-1159.65Apt1 domain-containing protein n=10 Tax=Aphanomyce... [more]
A0A024TSZ0_9STRA2.800e-1159.65Apt1 domain-containing protein n=2 Tax=Aphanomyces... [more]
A0A6G0XTM8_9STRA7.140e-1146.67Uncharacterized protein n=1 Tax=Aphanomyces euteic... [more]

Pages

back to top