Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99141.24030.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR007055 | BON domain | PFAM | PF04972 | BON | coord: 79..124 e-value: 4.4E-8 score: 33.3 |
None | No IPR available | TMHMM | TMhelix | | coord: 15..37 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig99141.24030.1 ID=prot_P-canaliculata_contig99141.24030.1|Name=mRNA_P-canaliculata_contig99141.24030.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=127bp GGGGGVGGGGGGGGAAGNAGAGLGGAGGFTGTTGGSVIRSNIRTRLRPAF SSPVIPPQITEFSFNDSLARQPTAQSLIGRYQVSIQNRKATVTGVVNSQA DADRLIRQLRLQPGVYGVINQLQVIR* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR007055 | BON_dom |
|