prot_P-canaliculata_contig9807.23904.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCRVDSSGCCSPTGCGRPPAACPRRSGAAGPAECPPCPGSSVSHHRWCPTVPRPE*102030405060708090Expect = 3.14e-15 / Id = 75.56Expect = 3.28e-14 / Id = 77.55Expect = 1.06e-13 / Id = 76.09Expect = 2.89e-13 / Id = 75.00Expect = 9.37e-13 / Id = 66.67Expect = 3.75e-12 / Id = 65.31Expect = 1.39e-10 / Id = 71.43Expect = 2.06e-9 / Id = 77.78Expect = 5.07e-9 / Id = 72.09Expect = 6.19e-9 / Id = 80.56SequenceA0A1A9YCQ2_GLOFFA0A640KV81_LEITAA0A7J6XJ70_TRYCRA0A151U6X1_CAJCAA0A3P9IMT4_ORYLAA0A5B6VED6_9ROSIA0A1B0BNV0_9MUSCA0A2P2LYM3_RHIMUA0A293MZJ1_ORNERA0A2P2JIT2_RHIMU
Match NameE-valueIdentityDescription
A0A1A9YCQ2_GLOFF3.140e-1575.56Uncharacterized protein n=1 Tax=Glossina fuscipes ... [more]
A0A640KV81_LEITA3.280e-1477.55Polyubiquitin, putative n=1 Tax=Leishmania tarento... [more]
A0A7J6XJ70_TRYCR1.060e-1376.09Uncharacterized protein n=2 Tax=Trypanosoma cruzi ... [more]
A0A151U6X1_CAJCA2.890e-1375.00Uncharacterized protein (Fragment) n=1 Tax=Cajanus... [more]
A0A3P9IMT4_ORYLA9.370e-1366.67Centromere protein V n=1 Tax=Oryzias latipes TaxID... [more]
A0A5B6VED6_9ROSI3.750e-1265.31Uncharacterized protein n=1 Tax=Gossypium australe... [more]
A0A1B0BNV0_9MUSC1.390e-1071.43Uncharacterized protein n=1 Tax=Glossina palpalis ... [more]
A0A2P2LYM3_RHIMU2.060e-977.78Polyubiquitin n=2 Tax=Rhizophora mucronata TaxID=6... [more]
A0A293MZJ1_ORNER5.070e-972.09Uncharacterized protein (Fragment) n=1 Tax=Ornitho... [more]
A0A2P2JIT2_RHIMU6.190e-980.56Uncharacterized protein n=1 Tax=Rhizophora mucrona... [more]

Pages

back to top