prot_P-canaliculata_contig9807.23904.1 (polypeptide) Pelvetia canaliculata dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A1A9YCQ2_GLOFF (Uncharacterized protein n=1 Tax=Glossina fuscipes fuscipes TaxID=201502 RepID=A0A1A9YCQ2_GLOFF) HSP 1 Score: 75.5 bits (184), Expect = 3.140e-15 Identity = 34/45 (75.56%), Postives = 41/45 (91.11%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTRC 45 +PSLSWIF T S+VSDGSTSKV+VFPVKV+T IC+PPRRR+T+C Sbjct: 93 IPSLSWIFALTFSIVSDGSTSKVMVFPVKVLTNICIPPRRRNTKC 137
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A640KV81_LEITA (Polyubiquitin, putative n=1 Tax=Leishmania tarentolae TaxID=5689 RepID=A0A640KV81_LEITA) HSP 1 Score: 76.6 bits (187), Expect = 3.280e-14 Identity = 38/49 (77.55%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCRVDS 49 MPSLSWI FT S+VS GSTS IV PV V TKICMPPRRRSTRC VDS Sbjct: 706 MPSLSWILAFTFSIVSLGSTSSAIVLPVSVFTKICMPPRRRSTRCSVDS 754
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A7J6XJ70_TRYCR (Uncharacterized protein n=2 Tax=Trypanosoma cruzi TaxID=5693 RepID=A0A7J6XJ70_TRYCR) HSP 1 Score: 75.1 bits (183), Expect = 1.060e-13 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 50 SGCCSPTGCGRPPAACPRRSGAAGPAECPPCPGSSVSHHRWCPTVP 95 SGCCS CGRPPAAC RRSGAAGPAECPPCPGSS S +WC +P Sbjct: 380 SGCCSLQACGRPPAACQRRSGAAGPAECPPCPGSSPSRSQWCRWIP 425
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A151U6X1_CAJCA (Uncharacterized protein (Fragment) n=1 Tax=Cajanus cajan TaxID=3821 RepID=A0A151U6X1_CAJCA) HSP 1 Score: 68.9 bits (167), Expect = 2.890e-13 Identity = 33/44 (75.00%), Postives = 38/44 (86.36%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTR 44 +PSLSWI FT SMVS+ STS+VIV PV+V+TKICMPPRRR TR Sbjct: 47 IPSLSWILVFTLSMVSELSTSRVIVLPVRVLTKICMPPRRRRTR 90
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A3P9IMT4_ORYLA (Centromere protein V n=1 Tax=Oryzias latipes TaxID=8090 RepID=A0A3P9IMT4_ORYLA) HSP 1 Score: 70.1 bits (170), Expect = 9.370e-13 Identity = 38/57 (66.67%), Postives = 42/57 (73.68%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCR----VDSSGCC 53 MPSLSWI FT SMVS GSTS+V+V PV+V+TKICMPP RR TR R V SG C Sbjct: 1 MPSLSWILAFTFSMVSLGSTSRVMVLPVRVLTKICMPPLRRRTRWRTMELVKHSGSC 57
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A5B6VED6_9ROSI (Uncharacterized protein n=1 Tax=Gossypium australe TaxID=47621 RepID=A0A5B6VED6_9ROSI) HSP 1 Score: 66.6 bits (161), Expect = 3.750e-12 Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCRVDS 49 +PSLSWI T SMVS+ STS+VIV PV+V+TKIC+PP +R T+ RVDS Sbjct: 60 IPSLSWILALTLSMVSELSTSRVIVLPVRVLTKICIPPLKRRTKWRVDS 108
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A1B0BNV0_9MUSC (Uncharacterized protein n=1 Tax=Glossina palpalis gambiensis TaxID=67801 RepID=A0A1B0BNV0_9MUSC) HSP 1 Score: 63.5 bits (153), Expect = 1.390e-10 Identity = 30/42 (71.43%), Postives = 35/42 (83.33%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRS 42 +PSLSWIF T S+VSD STSKV+V PVKV+T ICMPPR+ S Sbjct: 93 IPSLSWIFALTFSIVSDDSTSKVMVLPVKVLTNICMPPRKLS 134
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A2P2LYM3_RHIMU (Polyubiquitin n=2 Tax=Rhizophora mucronata TaxID=61149 RepID=A0A2P2LYM3_RHIMU) HSP 1 Score: 57.8 bits (138), Expect = 2.060e-9 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 14 MVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCRVDS 49 MVS+ STS+V+V PV+V TKICMPPRRRSTR RVDS Sbjct: 1 MVSELSTSRVMVLPVRVFTKICMPPRRRSTRWRVDS 36
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A293MZJ1_ORNER (Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MZJ1_ORNER) HSP 1 Score: 57.8 bits (138), Expect = 5.070e-9 Identity = 31/43 (72.09%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 1 MPSLSWIFCFTPSMVSDGSTSKVIVFPVKVVTKICMPPRRRST 43 MPSLS I T SMVS GSTS+VIV PV V T ICMPPR RST Sbjct: 34 MPSLSCILALTFSMVSLGSTSRVIVLPVIVFTNICMPPRSRST 76
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Match: A0A2P2JIT2_RHIMU (Uncharacterized protein n=1 Tax=Rhizophora mucronata TaxID=61149 RepID=A0A2P2JIT2_RHIMU) HSP 1 Score: 56.6 bits (135), Expect = 6.190e-9 Identity = 29/36 (80.56%), Postives = 31/36 (86.11%), Query Frame = 0 Query: 14 MVSDGSTSKVIVFPVKVVTKICMPPRRRSTRCRVDS 49 MVS STS+VIVFPV+V TKICMPPR RSTR RVDS Sbjct: 1 MVSLLSTSRVIVFPVRVFTKICMPPRSRSTRWRVDS 36 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig9807.23904.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig9807.23904.1 ID=prot_P-canaliculata_contig9807.23904.1|Name=mRNA_P-canaliculata_contig9807.23904.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=99bpback to top |