prot_P-canaliculata_contig97848.23882.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig97848.23882.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
GARIKHGDNDGEFILPESRRWKADGYIAASNTVLEFHGTYWHGHPSVYQQDIVHPQDRQGRTYGTLYKNTLSREEMIRGWGYNLIVMWEHDWKR102030405060708090Expect = 1.04e-23 / Id = 47.31Expect = 3.68e-23 / Id = 48.39Expect = 9.30e-23 / Id = 46.15Expect = 2.14e-21 / Id = 43.82Expect = 3.12e-20 / Id = 45.68Expect = 3.17e-20 / Id = 44.57Expect = 3.52e-19 / Id = 40.86Expect = 1.15e-18 / Id = 44.57Expect = 1.29e-16 / Id = 40.66Expect = 1.02e-14 / Id = 44.71SequenceA0A6C0D5K7_9ZZZZA0A6C0H9F0_9ZZZZA0A6C0EUH5_9ZZZZG8DD29_9PHYCA0A248SJ99_9CAUDA0A1X6WF38_9VIRUA0A3G4ZRH9_9VIRUA0A7D3UF21_9VIRUA0A4Q0AVZ5_9BACTA0A6M6DJI1_9VIRU
Match NameE-valueIdentityDescription
A0A6C0D5K7_9ZZZZ1.040e-2347.31Uncharacterized protein n=1 Tax=viral metagenome T... [more]
A0A6C0H9F0_9ZZZZ3.680e-2348.39Uncharacterized protein n=1 Tax=viral metagenome T... [more]
A0A6C0EUH5_9ZZZZ9.300e-2346.15Uncharacterized protein n=1 Tax=viral metagenome T... [more]
G8DD29_9PHYC2.140e-2143.82Uncharacterized protein n=1 Tax=Micromonas pusilla... [more]
A0A248SJ99_9CAUD3.120e-2045.68Uncharacterized protein n=1 Tax=Salicola phage SCT... [more]
A0A1X6WF38_9VIRU3.170e-2044.57Probable Zinc-ribbon domain-containing protein n=2... [more]
A0A3G4ZRH9_9VIRU3.520e-1940.86Uncharacterized protein n=1 Tax=Terrestrivirus sp.... [more]
A0A7D3UF21_9VIRU1.150e-1844.57Uncharacterized protein n=1 Tax=Faustovirus TaxID=... [more]
A0A4Q0AVZ5_9BACT1.290e-1640.66Uncharacterized protein n=1 Tax=Hydrotalea sp. AMD... [more]
A0A6M6DJI1_9VIRU1.020e-1444.71Zinc-ribbon domain protein n=1 Tax=Faustovirus Tax... [more]

Pages

back to top