prot_P-canaliculata_contig97.23754.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig97.23754.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
KSSFSYQGGRHQYYSLLLPGDHRTHGYVYPNTVSGLPWSSGFRINHHERKVQLIDPHDSDPAAAASRAFAKTIGAAIQ*10203040506070Expect = 5.83e-13 / Id = 49.23Expect = 2.73e-12 / Id = 49.23Expect = 3.98e-10 / Id = 49.23Expect = 4.75e-10 / Id = 47.69Expect = 9.05e-10 / Id = 46.97Expect = 1.25e-9 / Id = 47.69Expect = 1.72e-9 / Id = 42.11Expect = 1.78e-9 / Id = 45.45Expect = 2.13e-9 / Id = 44.62Expect = 3.21e-9 / Id = 44.62SequenceC9SRU9_VERA1A0A3M9YJF1_9PEZIA0A3E2HCU9_SCYLIR8BJX8_PHAM7A0A8H4Y7H1_9HYPOA0A4Q4UVN0_9PEZIA0A2I0RU38_9PEZIA0A423X3D9_9PEZIA0A0G4KCB7_9PEZIS3CQE9_GLAL2
Match NameE-valueIdentityDescription
C9SRU9_VERA15.830e-1349.23Uncharacterized protein n=1 Tax=Verticillium alfal... [more]
A0A3M9YJF1_9PEZI2.730e-1249.23Nudix hydrolase domain-containing protein n=7 Tax=... [more]
A0A3E2HCU9_SCYLI3.980e-1049.23Nudix hydrolase domain-containing protein (Fragmen... [more]
R8BJX8_PHAM74.750e-1047.69Putative nudix domain-containing protein n=1 Tax=P... [more]
A0A8H4Y7H1_9HYPO9.050e-1046.97Nudix hydrolase domain-containing protein n=1 Tax=... [more]
A0A4Q4UVN0_9PEZI1.250e-947.69Nudix hydrolase domain-containing protein n=2 Tax=... [more]
A0A2I0RU38_9PEZI1.720e-942.11Nudix hydrolase domain-containing protein n=1 Tax=... [more]
A0A423X3D9_9PEZI1.780e-945.45Nudix hydrolase domain-containing protein n=1 Tax=... [more]
A0A0G4KCB7_9PEZI2.130e-944.62Nudix hydrolase domain-containing protein n=4 Tax=... [more]
S3CQE9_GLAL23.210e-944.62Nudix n=1 Tax=Glarea lozoyensis (strain ATCC 20868... [more]

Pages

back to top