prot_P-canaliculata_contig102209.346.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig102209.346.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 7
ZOOM
x 1
POSITION
0
MSKFFYPFNPILTPPLTGVRAINSEATFLQITLVPSLAEIDRVWFAAGPLITLGQLESELFIFSS5101520253035404550556065Expect = 2.95e-12 / Id = 61.40Expect = 1.56e-9 / Id = 54.24Expect = 4.07e-9 / Id = 50.85Expect = 5.56e-9 / Id = 54.39Expect = 7.61e-9 / Id = 52.63Expect = 1.95e-8 / Id = 50.88Expect = 4.90e-5 / Id = 44.07SequenceA0A517P1Z1_9BACTA0A0J1B525_RHOISA0A5C6EQK6_9BACTA0A2G1W510_9BACTQ7UUD0_RHOBAUPI001E3CABFDA0A5C6DTD9_9BACT
Match NameE-valueIdentityDescription
A0A517P1Z1_9BACT2.950e-1261.40Outer membrane protein transport protein (OMPP1/Fa... [more]
A0A0J1B525_RHOIS1.560e-954.24Membrane protein involved in aromatic hydrocarbon ... [more]
A0A5C6EQK6_9BACT4.070e-950.85Outer membrane protein transport protein (OMPP1/Fa... [more]
A0A2G1W510_9BACT5.560e-954.39Hydrocarbon degradation protein n=1 Tax=Rhodopirel... [more]
Q7UUD0_RHOBA7.610e-952.63Uncharacterized protein n=7 Tax=Rhodopirellula Tax... [more]
UPI001E3CABFD1.950e-850.88outer membrane protein transport protein n=2 Tax=u... [more]
A0A5C6DTD9_9BACT4.900e-544.07Outer membrane protein transport protein (OMPP1/Fa... [more]
back to top