mRNA_P-canaliculata_contig99818.24098.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig99818.24098.1 vs. uniprot
Match: A0A423S3E3_9BURK (Uncharacterized protein n=1 Tax=Pusillimonas sp. NJUB218 TaxID=2023230 RepID=A0A423S3E3_9BURK) HSP 1 Score: 52.8 bits (125), Expect = 2.460e-6 Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 1 Query: 1 MALTVEDGSGTDTSVNSYVSVTEFTEFLTNRNLSVTAGSE---EALILRATDIIEQQN-YKGNKTTTTQALSFPR 213 MAL VEDG+G++ S SY+SV + T + NL T GSE EA + RAT ++ + YKG + T +QAL++PR Sbjct: 1 MALIVEDGTGSNPSAESYISVADCTTYAAAHNLVFT-GSESEQEARLRRATQYLDAEYAYKGEQLTASQALAWPR 74
BLAST of mRNA_P-canaliculata_contig99818.24098.1 vs. uniprot
Match: A0A5H2QAA3_9CAUD (Structural protein n=1 Tax=Achromobacter phage vB_Ade_ART TaxID=2292880 RepID=A0A5H2QAA3_9CAUD) HSP 1 Score: 50.8 bits (120), Expect = 1.720e-5 Identity = 35/99 (35.35%), Postives = 60/99 (60.61%), Query Frame = 1 Query: 1 MALTVEDGSGTDTSVNSYVSVTEFTEFLTNRNLSVTAGSE--EALILRATDIIEQ--QNYKGNKTTTTQALSFPRSNIY-DKENISYDENSIPKSIKIS 282 MAL VEDG+G +T+ NSY+ V + +R L ++ E I+ A D +E + +KG + T+TQALS+PR+++ D E ++ ++ IP +K++ Sbjct: 1 MALIVEDGTGKETA-NSYIDVQFARAYAQSRGLPISDDDAVVEGWIVMACDYVESFAEQFKGKRKTSTQALSWPRTDVVIDGE--AFPDDKIPTQLKLA 96
BLAST of mRNA_P-canaliculata_contig99818.24098.1 vs. uniprot
Match: UPI000E20F2BA (hypothetical protein n=1 Tax=Escherichia coli TaxID=562 RepID=UPI000E20F2BA) HSP 1 Score: 49.7 bits (117), Expect = 4.450e-5 Identity = 29/93 (31.18%), Postives = 54/93 (58.06%), Query Frame = 1 Query: 1 MALTVEDGSGTDTSVNSYVSVTEFTEF--LTNRNLSVTAGSEEALILRATDIIEQQ---NYKGNKTTTTQALSFPRSNIYDKENISYDENSIP 264 MAL +E GS + N+++S+ +F + L + T A ++R+ + +E + + G+K + QALS+PR N+YD+++ SYD + +P Sbjct: 1 MALIIETGSVVP-NANTFISLDDFKAYCILVGYLIETTDDEVSAALVRSANYLENRYRTRWVGSKASRDQALSWPRKNVYDEDDYSYDSDVVP 92 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99818.24098.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig99818.24098.1 >prot_P-canaliculata_contig99818.24098.1 ID=prot_P-canaliculata_contig99818.24098.1|Name=mRNA_P-canaliculata_contig99818.24098.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=103bp MALTVEDGSGTDTSVNSYVSVTEFTEFLTNRNLSVTAGSEEALILRATDIback to top mRNA from alignment at P-canaliculata_contig99818:79..387- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig99818.24098.1 ID=mRNA_P-canaliculata_contig99818.24098.1|Name=mRNA_P-canaliculata_contig99818.24098.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=309bp|location=Sequence derived from alignment at P-canaliculata_contig99818:79..387- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig99818:79..387- >mRNA_P-canaliculata_contig99818.24098.1 ID=mRNA_P-canaliculata_contig99818.24098.1|Name=mRNA_P-canaliculata_contig99818.24098.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=618bp|location=Sequence derived from alignment at P-canaliculata_contig99818:79..387- (Pelvetia canaliculata dioecious)back to top |