mRNA_P-canaliculata_contig99713.24088.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig99713.24088.1 vs. uniprot
Match: A0A5C6CCP2_9BACT (Transposase for transposon Tn5 n=1 Tax=Novipirellula galeiformis TaxID=2528004 RepID=A0A5C6CCP2_9BACT) HSP 1 Score: 67.8 bits (164), Expect = 8.120e-11 Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = 3 Query: 177 QERNTSQRLMRDRKSLSWGQLVEQVGPPPAETQWINVCNCNADYFAFYCRMIDQGHDWVVR 359 ++ + +QRL R R+ WG++V+QVGPPP +QWI+V + D F +C + G DWVVR Sbjct: 148 KKESRTQRLKRTREGCYWGEVVDQVGPPPEGSQWIHVFDRGGDNFESFCHLAQSGCDWVVR 208
BLAST of mRNA_P-canaliculata_contig99713.24088.1 vs. uniprot
Match: UPI0019A1523D (IS4 family transposase n=1 Tax=Pirellulaceae bacterium TaxID=2699754 RepID=UPI0019A1523D) HSP 1 Score: 61.2 bits (147), Expect = 1.600e-8 Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = 3 Query: 198 RLMRDRKSLSWGQLVEQVGPPPAETQWINVCNCNADYFAFYCRMIDQGHDWVVR 359 RL R R+S WGQ+++QVGPPP ++ +V + D F YC ++ Q DWVVR Sbjct: 156 RLQRPRESRLWGQVIDQVGPPPENVRFTHVFDRGGDNFEVYCHLLLQRTDWVVR 209 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99713.24088.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig99713.24088.1 >prot_P-canaliculata_contig99713.24088.1 ID=prot_P-canaliculata_contig99713.24088.1|Name=mRNA_P-canaliculata_contig99713.24088.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=52bp MRDRKSLSWGQLVEQVGPPPAETQWINVCNCNADYFAFYCRMIDQGHDWVback to top mRNA from alignment at P-canaliculata_contig99713:8..366- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig99713.24088.1 ID=mRNA_P-canaliculata_contig99713.24088.1|Name=mRNA_P-canaliculata_contig99713.24088.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=359bp|location=Sequence derived from alignment at P-canaliculata_contig99713:8..366- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig99713:8..366- >mRNA_P-canaliculata_contig99713.24088.1 ID=mRNA_P-canaliculata_contig99713.24088.1|Name=mRNA_P-canaliculata_contig99713.24088.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=312bp|location=Sequence derived from alignment at P-canaliculata_contig99713:8..366- (Pelvetia canaliculata dioecious)back to top |