mRNA_P-canaliculata_contig99627.24076.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig99627.24076.1 vs. uniprot
Match: UPI0013EA2E4C (hypothetical protein n=1 Tax=unclassified Paludisphaera TaxID=2624067 RepID=UPI0013EA2E4C) HSP 1 Score: 78.2 bits (191), Expect = 3.310e-16 Identity = 36/88 (40.91%), Postives = 55/88 (62.50%), Query Frame = 1 Query: 31 IKLKIHVVFYKDSLGDWIAHCLEMDLCGHGASQVSAVKMLNDAIAMQIEFSLAGDNPENIFSPADAKFFQMFAEGDDKLVGNLEVTIE 294 ++L + +VFY++ W+AHCLE DL G G ++ A+ L DA +Q E S DNP N FSPA+ ++F+M+A G D ++V+ E Sbjct: 7 LRLSLRIVFYRED-ESWVAHCLETDLVGVGETKREAMATLWDATTLQFEASREWDNPANFFSPAEGRYFEMYARGRDVATAEMDVSAE 93 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99627.24076.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig99627.24076.1 >prot_P-canaliculata_contig99627.24076.1 ID=prot_P-canaliculata_contig99627.24076.1|Name=mRNA_P-canaliculata_contig99627.24076.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=116bp MPEIKLKIHVVFYKDSLGDWIAHCLEMDLCGHGASQVSAVKMLNDAIAMQback to top mRNA from alignment at P-canaliculata_contig99627:492..860- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig99627.24076.1 ID=mRNA_P-canaliculata_contig99627.24076.1|Name=mRNA_P-canaliculata_contig99627.24076.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=369bp|location=Sequence derived from alignment at P-canaliculata_contig99627:492..860- (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig99627:492..860- >mRNA_P-canaliculata_contig99627.24076.1 ID=mRNA_P-canaliculata_contig99627.24076.1|Name=mRNA_P-canaliculata_contig99627.24076.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=696bp|location=Sequence derived from alignment at P-canaliculata_contig99627:492..860- (Pelvetia canaliculata dioecious)back to top |