mRNA_P-canaliculata_contig101442.237.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig101442.237.1 vs. uniprot
Match: A0A517ZN86_9PLAN (Uncharacterized protein n=1 Tax=Symmachiella dynata TaxID=2527995 RepID=A0A517ZN86_9PLAN) HSP 1 Score: 67.0 bits (162), Expect = 1.110e-10 Identity = 35/70 (50.00%), Postives = 50/70 (71.43%), Query Frame = 1 Query: 313 EDDSLI-QKLLGIFQTTSIIRLALIEGAVFFNFMMFMTENHPVNLGIGVFGLLLLLIAIPFPTRVWSWVE 519 E DS++ Q+L G++Q +SII A++EGA+F N + TE HPVNL IG +LLLL +IP +R+ +WVE Sbjct: 99 ESDSVVFQQLYGVYQYSSIIAAAILEGAIFLNLFAYFTEGHPVNLVIGGAFILLLLTSIPTASRIQNWVE 168
BLAST of mRNA_P-canaliculata_contig101442.237.1 vs. uniprot
Match: A0A2E7NJ41_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7NJ41_9PLAN) HSP 1 Score: 50.8 bits (120), Expect = 7.810e-5 Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 1 Query: 334 KLLGIFQTTSIIRLALIEGAVFFNFMMFMTENHPVNLGIGVFGLLLLLIAIPFPTR--VWSWVE 519 +LLG++Q I+ LAL+EGA FFN ++F E+H +L +G G+LLLL+ +PTR + SW+ Sbjct: 83 ELLGLYQVRLIVGLALLEGAAFFNILVFSMEHHWASLMVG--GILLLLMLPRWPTRSKIESWIR 144 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig101442.237.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig101442.237.1 >prot_P-canaliculata_contig101442.237.1 ID=prot_P-canaliculata_contig101442.237.1|Name=mRNA_P-canaliculata_contig101442.237.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=173bp MISDSVRSAFEPQTRVMLIIGAAMFLGACFFGVFVCAMADWAELKNVQAMback to top mRNA from alignment at P-canaliculata_contig101442:138..656+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig101442.237.1 ID=mRNA_P-canaliculata_contig101442.237.1|Name=mRNA_P-canaliculata_contig101442.237.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=519bp|location=Sequence derived from alignment at P-canaliculata_contig101442:138..656+ (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig101442:138..656+ >mRNA_P-canaliculata_contig101442.237.1 ID=mRNA_P-canaliculata_contig101442.237.1|Name=mRNA_P-canaliculata_contig101442.237.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=1038bp|location=Sequence derived from alignment at P-canaliculata_contig101442:138..656+ (Pelvetia canaliculata dioecious)back to top |