mRNA_P-canaliculata_contig100479.109.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig100479.109.1 vs. uniprot
Match: A0A2Z2NW59_9GAMM (Uncharacterized protein n=1 Tax=Granulosicoccus antarcticus IMCC3135 TaxID=1192854 RepID=A0A2Z2NW59_9GAMM) HSP 1 Score: 59.7 bits (143), Expect = 4.060e-9 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 34 DARSIALGGAVIANGKGVHGALANPASMMAMQRRGETTH 150 DARSIALGG+VIANG+GVHGA+ NPAS+MAMQ+R ET H Sbjct: 59 DARSIALGGSVIANGQGVHGAVDNPASLMAMQQRKETFH 97
BLAST of mRNA_P-canaliculata_contig100479.109.1 vs. uniprot
Match: A0A848U6V8_9GAMM (Conjugal transfer protein TraF n=1 Tax=Granulosicoccus sp. TaxID=1943584 RepID=A0A848U6V8_9GAMM) HSP 1 Score: 58.9 bits (141), Expect = 7.600e-9 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 34 DARSIALGGAVIANGKGVHGALANPASMMAMQRRGETTH 150 DARSIALGG+VIANG+GVHGAL NPAS+MAM+RR E H Sbjct: 55 DARSIALGGSVIANGQGVHGALENPASLMAMKRRKEKFH 93 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100479.109.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig100479.109.1 >prot_P-canaliculata_contig100479.109.1 ID=prot_P-canaliculata_contig100479.109.1|Name=mRNA_P-canaliculata_contig100479.109.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=50bp TLCANSVAAASDARSIALGGAVIANGKGVHGALANPASMMAMQRRGETTHback to top mRNA from alignment at P-canaliculata_contig100479:876..1025+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig100479.109.1 ID=mRNA_P-canaliculata_contig100479.109.1|Name=mRNA_P-canaliculata_contig100479.109.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=150bp|location=Sequence derived from alignment at P-canaliculata_contig100479:876..1025+ (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig100479:876..1025+ >mRNA_P-canaliculata_contig100479.109.1 ID=mRNA_P-canaliculata_contig100479.109.1|Name=mRNA_P-canaliculata_contig100479.109.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=300bp|location=Sequence derived from alignment at P-canaliculata_contig100479:876..1025+ (Pelvetia canaliculata dioecious)back to top |